KEGG   Drosophila simulans: Dsimw501_GD24084Help
Entry
Dsimw501_GD24084  CDS       T01065                                 

Gene name
Dsim_GD24084
Definition
(RefSeq) GD24084 gene product from transcript GD24084-RA
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dsi  Drosophila simulans
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD24084 (Dsim_GD24084)
   00053 Ascorbate and aldarate metabolism
    Dsimw501_GD24084 (Dsim_GD24084)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsimw501_GD24084 (Dsim_GD24084)
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD24084 (Dsim_GD24084)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsimw501_GD24084 (Dsim_GD24084)
   00982 Drug metabolism - cytochrome P450
    Dsimw501_GD24084 (Dsim_GD24084)
   00983 Drug metabolism - other enzymes
    Dsimw501_GD24084 (Dsim_GD24084)
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsimw501_GD24084 (Dsim_GD24084)
Glycosyltransferases [BR:dsi01003]
 Others
  Hydrophobic molecule
   Dsimw501_GD24084 (Dsim_GD24084)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2L
AA seq 539 aa AA seqDB search
MIEYTKIGFLIVLLLGTKTQSSDGANILGVFGTHSPSHVIVHMAVMKALADRGHNITVVT
QMKPKMAAHENITVIIAPPTEERHKFIKEYMAEVSNEKPSFWETMVKAIVQSSNQLEGQY
EFMMHPNFKEIYENPKTKFDLVILGLMANNYQLGIAAKLKCPVIISWVGIPLPFMDSIVG
NVNDPSYVPTVNVALKAGQNTMDFGLRFVNFLKYGVMCVFETVLDYKMNQFYERAFANEL
EFPDYQEMKRRVSLLFYNYHSPSEGPIRPTVPQSIEIGGIQVKEQADPLPKELAKFLDNA
DEGAIFFSLGTNVNTNTFRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGNASNIFFGNWL
PQDDILAHPNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNAEIMTKSGFGRWLDI
LTMTENELKETIHEVLENPTYRETIGKFSTLYRDRPLTARQSVIYWTEYVLRYQGALHLQ
SPIIHTDFVARNNLDVYGVVLLVSILLIVIIRFLFRKILNVASGYSNRRESLAKKLKSN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatatactaaaatcggatttttgattgtattgcttttgggcacgaagacccaa
agcagcgatggagccaatatattgggagttttcgggacccacagtccttcgcacgtgatc
gtgcatatggctgtgatgaaagcccttgcagatcggggtcacaacattacagtggtgacc
cagatgaaaccgaaaatggcggcacatgaaaatattaccgtgatcattgcaccgccgacg
gaggagagacataaatttatcaaagaatatatggctgaggtatctaatgagaagccgtcg
ttctgggagaccatggtcaaagcgatcgtccaatcatccaatcaactggaaggacagtat
gaatttatgatgcatcccaatttcaaagagatctacgagaatccaaagaccaaattcgat
ttggtgattttgggtttgatggccaacaactatcagttgggcattgctgccaagttgaaa
tgtccggtcattatttcgtgggtgggcattccactgcccttcatggacagcattgtgggt
aatgtcaacgatccatcgtatgtcccgaccgtaaatgtagcccttaaagcggggcaaaac
accatggactttggcctaagatttgtgaattttttgaaatatggcgtcatgtgcgttttt
gagacagtattggactataaaatgaaccagttttacgagcgagcttttgcaaatgaattg
gagtttccagactatcaagagatgaagcgccgagtttccttgttgttctataattaccat
tcccccagcgaaggacccatcagaccaacagtacctcaatccatagaaattggcggaata
caagtaaaagagcaggccgatcctctgcccaaggagttggccaagtttcttgataacgct
gatgagggcgcgatatttttcagcctaggcactaatgtgaatacgaatacctttcgaccc
gataccgtggatatcctgtacaaagtgctatccaagttgcctcagagagttatttggaag
tgggaggacctgaaaaacaagcccggaaatgcctccaacatattcttcggcaattggctg
ccccaggacgatatcttggcccatccgaacaccaaactattcataacccatgcgggcaag
ggcggtgtggcagaggcccaatatcatggagttcccatggtggcgctaccgatctttggc
gatcaacagggaaatgctgaaatcatgacaaaatctggctttggccgatggttggatatt
ctcacaatgacggagaatgaactgaaggagactatccatgaggtcctggagaatcccacg
tatcgtgagacgatcggaaagttctccaccctttacagggatcgtccgttaacagcccgt
cagtcggtcatctactggaccgagtacgtgttgcgttatcaaggagcacttcacctgcag
agtcccatcattcacacagactttgtggctcgaaacaatctcgatgtctatggagtagtt
ctcctggtcagtattctactcatagtcattattaggtttctatttcgcaagattttaaat
gttgcgagtggatacagtaatcgtcgcgaatcgctggcgaaaaagcttaaaagtaattaa

DBGET integrated database retrieval system