KEGG   Drosophila simulans: Dsimw501_GD24084Help
Entry
Dsimw501_GD24084  CDS       T01065                                 

Gene name
Dsim_GD24084
Definition
(RefSeq) GD24084 gene product from transcript GD24084-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dsi  Drosophila simulans
Pathway
dsi00040  Pentose and glucuronate interconversions
dsi00053  Ascorbate and aldarate metabolism
dsi00830  Retinol metabolism
dsi00860  Porphyrin and chlorophyll metabolism
dsi00980  Metabolism of xenobiotics by cytochrome P450
dsi00982  Drug metabolism - cytochrome P450
dsi00983  Drug metabolism - other enzymes
dsi01100  Metabolic pathways
Module
dsi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD24084 (Dsim_GD24084)
   00053 Ascorbate and aldarate metabolism
    Dsimw501_GD24084 (Dsim_GD24084)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsimw501_GD24084 (Dsim_GD24084)
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD24084 (Dsim_GD24084)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsimw501_GD24084 (Dsim_GD24084)
   00982 Drug metabolism - cytochrome P450
    Dsimw501_GD24084 (Dsim_GD24084)
   00983 Drug metabolism - other enzymes
    Dsimw501_GD24084 (Dsim_GD24084)
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsimw501_GD24084 (Dsim_GD24084)
Glycosyltransferases [BR:dsi01003]
 Others
  Hydrophobic molecule
   Dsimw501_GD24084 (Dsim_GD24084)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_2 Glyco_trans_1_3 Glyco_transf_4 Sigma54_AID
Motif
Other DBs
NCBI-GeneID: 6732561
NCBI-ProteinID: XP_002079680
UniProt: B4Q7G7
Position
2L
AA seq 539 aa AA seqDB search
MIEYTKIGFLIVLLLGTKTQSSDGANILGVFGTHSPSHVIVHMAVMKALADRGHNITVVT
QMKPKMAAHENITVIIAPPTEERHKFIKEYMAEVSNEKPSFWETMVKAIVQSSNQLEGQY
EFMMHPNFKEIYENPKTKFDLVILGLMANNYQLGIAAKLKCPVIISWVGIPLPFMDSIVG
NVNDPSYVPTVNVALKAGQNTMDFGLRFVNFLKYGVMCVFETVLDYKMNQFYERAFANEL
EFPDYQEMKRRVSLLFYNYHSPSEGPIRPTVPQSIEIGGIQVKEQADPLPKELAKFLDNA
DEGAIFFSLGTNVNTNTFRPDTVDILYKVLSKLPQRVIWKWEDLKNKPGNASNIFFGNWL
PQDDILAHPNTKLFITHAGKGGVAEAQYHGVPMVALPIFGDQQGNAEIMTKSGFGRWLDI
LTMTENELKETIHEVLENPTYRETIGKFSTLYRDRPLTARQSVIYWTEYVLRYQGALHLQ
SPIIHTDFVARNNLDVYGVVLLVSILLIVIIRFLFRKILNVASGYSNRRESLAKKLKSN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatatactaaaatcggatttttgattgtattgcttttgggcacgaagacccaa
agcagcgatggagccaatatattgggagttttcgggacccacagtccttcgcacgtgatc
gtgcatatggctgtgatgaaagcccttgcagatcggggtcacaacattacagtggtgacc
cagatgaaaccgaaaatggcggcacatgaaaatattaccgtgatcattgcaccgccgacg
gaggagagacataaatttatcaaagaatatatggctgaggtatctaatgagaagccgtcg
ttctgggagaccatggtcaaagcgatcgtccaatcatccaatcaactggaaggacagtat
gaatttatgatgcatcccaatttcaaagagatctacgagaatccaaagaccaaattcgat
ttggtgattttgggtttgatggccaacaactatcagttgggcattgctgccaagttgaaa
tgtccggtcattatttcgtgggtgggcattccactgcccttcatggacagcattgtgggt
aatgtcaacgatccatcgtatgtcccgaccgtaaatgtagcccttaaagcggggcaaaac
accatggactttggcctaagatttgtgaattttttgaaatatggcgtcatgtgcgttttt
gagacagtattggactataaaatgaaccagttttacgagcgagcttttgcaaatgaattg
gagtttccagactatcaagagatgaagcgccgagtttccttgttgttctataattaccat
tcccccagcgaaggacccatcagaccaacagtacctcaatccatagaaattggcggaata
caagtaaaagagcaggccgatcctctgcccaaggagttggccaagtttcttgataacgct
gatgagggcgcgatatttttcagcctaggcactaatgtgaatacgaatacctttcgaccc
gataccgtggatatcctgtacaaagtgctatccaagttgcctcagagagttatttggaag
tgggaggacctgaaaaacaagcccggaaatgcctccaacatattcttcggcaattggctg
ccccaggacgatatcttggcccatccgaacaccaaactattcataacccatgcgggcaag
ggcggtgtggcagaggcccaatatcatggagttcccatggtggcgctaccgatctttggc
gatcaacagggaaatgctgaaatcatgacaaaatctggctttggccgatggttggatatt
ctcacaatgacggagaatgaactgaaggagactatccatgaggtcctggagaatcccacg
tatcgtgagacgatcggaaagttctccaccctttacagggatcgtccgttaacagcccgt
cagtcggtcatctactggaccgagtacgtgttgcgttatcaaggagcacttcacctgcag
agtcccatcattcacacagactttgtggctcgaaacaatctcgatgtctatggagtagtt
ctcctggtcagtattctactcatagtcattattaggtttctatttcgcaagattttaaat
gttgcgagtggatacagtaatcgtcgcgaatcgctggcgaaaaagcttaaaagtaattaa

DBGET integrated database retrieval system