KEGG   Drosophila simulans: Dsim_GD24321Help
Entry
Dsim_GD24321      CDS       T01065                                 

Definition
GD24321 gene product from transcript GD24321-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dsi  Drosophila simulans
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dsi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 913 aa AA seqDB search
MALKMRIAIIGQSNFAADVLELLLDRPNIQIVGVFTIPDRGSREDILATTAIIHNIPVFK
FACWRRKGVALPEVLEQYKSVGATLNVLPFCSQFIPMEVIDGALLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDTIYKRFLYPEGVKA
MGVAVDMVASGVAPKIIQAEVGATYDPAMFKTENQVINLQATAEKIWNFVRGLDSVPGAI
ATVLHENGTEEQIRLFGAHLYSAGPVSNGKALRLRGLTKTAWIHSGGLLIEGTDGVFVNI
RRIKRDTKVINASEWFKQAEDQSITDFSEDELVKRSLVAGIWKAILKEDVDSSTDFFASG
AGSMDVVRLVEEVKETFDVPLQNEQVFMAPVFEEFFSLLVRFLRQGSACSDDQQLNFQAF
TLKANKREIRVPTQLFINGEFVDSDSQRTLEIVNPTNEEVICKVACASATDVDKAVQAAH
SAFYGSWRQITPRQRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVRAGFPPGVINVLPGKGSDAGQAVADHELVRKLGFTG
STPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDMDKAVRHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGA
KLVYGGCRVPHLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFNGSDVDSLMQRANR
TEYGLASGVFTKDIGKALNFADRIEAGTVFVNLYNKTDVAAPFGGFKQSGYGKDLGQEAL
NEYLKTKCVTVEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaaatgagaatcgcaattataggacagagcaattttgctgctgatgttctg
gagcttctgttggatcgcccaaatatccaaattgtaggagtcttcactattccagataga
ggcagtcgagaggacattttggccactactgctatcatccacaatatacctgttttcaag
ttcgcatgctggcgtcgcaagggcgtggcactacctgaggtcttggaacaatacaagtcc
gtgggggctaccctgaatgtgttgcccttctgttctcaattcattcccatggaggtgatt
gacggggcgctattgggcagcatttgttaccacccgtctattctcccacgtcaccgcgga
gctagtgctatatcgtggacactgatcgaaggggacgaggtggccggcttcagcatcttt
tgggcagatgacggtcttgacacaggacccctgctgctaacccgacaaacaaacctggaa
cccacggacacgctggacaccatatacaagcgctttttgtaccccgaaggtgtaaaggcg
atgggtgtcgccgtggacatggtcgctagtggtgtggcacccaagataatccaggcggaa
gtgggggcaacctacgacccggctatgtttaaaacagaaaatcaggttatcaaccttcag
gctacagcagaaaaaatttggaactttgttcgtggtctggactcagttcctggagccata
gcaacggttctacatgagaatggcacagaggagcaaattcgactatttggtgctcatttg
tactctgctggccccgtgtcaaatggaaaagctctacgtctaaggggcctaacaaagacc
gcctggatacacagcggtggtcttcttatagagggaaccgacggtgtctttgtcaacata
cgccgcattaagcgtgacacaaaggtaataaatgccagcgagtggtttaagcaagctgag
gaccagtctatcactgacttcagcgaggacgaattggtaaagcgatcgttggtggccgga
atttggaaggcaatacttaaggaagatgtcgactcatcgactgatttctttgcatccgga
gctggttcaatggacgtggtacgcttagtcgaggaagttaaagaaacctttgacgtgccg
ctgcagaacgagcaagttttcatggcgcctgtgtttgaggaattctttagcctgctggtt
aggttccttcgacagggaagtgcctgttccgatgaccagcagctcaactttcaggcattc
acgctgaaagccaacaaaagagagattcgagtgcccacacaactttttataaacggagag
tttgttgactccgattctcaacgcactttggaaattgttaaccccactaatgaggaagtg
atttgtaaagtggcatgcgcctcggccaccgacgtggacaaggcagtgcaagcagcccat
tctgccttttatggatcttggaggcagataacacccagacaacgaggccagttgatgctc
aatttggctgatctgatggaacgcaataaggaggagctggccacaattgagtcagtcgat
tcgggagcggtttacactctagcccttaaaacccacgttggaatgtccatcgaagcgtgg
cgctactttgccggatggtgcgacaagatccagggcaacacaatccctgttaaccctgcg
agacccaacaacgtactgaccttcacccgtaaggagccaattggtgtgtgcggtttaata
acgccttggaactaccctctgatgatgctttcatggaaaatggccgcctgcattgccgcc
gggaatacctgtctcataaagcctgctcagacctgccccctgaccgctctaaagtttgca
gagctaactgtccgagccggattcccccccggcgtgatcaatgtcctgcctggaaaaggt
tcagatgcgggccaggcagtggcagatcatgagctggtccgcaaactggggtttaccggg
tccacacccattggcaagcacattatgaagtcatgcgcagactccaaccttaaaaagtgc
tccctggagctgggcggcaagagcccgcttattatctttgcagattgtgatatggacaaa
gccgtcagacacggcatgtcctcggtgttttttaataaaggagagaactgcatcgccgcg
ggacggcttttcgtggaggatcggatacatgatgaatttatccgacgcgttcttaaggat
ctgcgcaccatgaccatcggggacccgcttgaccgctcgacggcccacgggcctcagaac
cacaaggcgcactttgacaaacttctggagttttgtagacgtggggtagacgagggcgcg
aagctggtgtacgggggatgtcgagtcccacaccttaagggatatttctttactcccaca
gtgttcacgaacgttacggacgatatgttcattgcccaagaggagtcctttggaccgatt
atgataatatccaagttcaacggcagcgatgtagattccttgatgcagcgggctaatcgc
acggagtatggcttggccagtggcgttttcacaaaggatattggcaaagcgcttaacttt
gctgatcgcattgaggccggcactgtgttcgtcaatttatacaataagactgatgtggca
gctccatttggtggctttaagcagagcggttatggcaaggacttggggcaggaggcgctc
aacgagtaccttaagaccaagtgtgtcacagttgaatattag

DBGET integrated database retrieval system