KEGG   Drosophila simulans: Dsimw501_GD24321Help
Entry
Dsimw501_GD24321  CDS       T01065                                 

Gene name
Dsim_GD24321
Definition
(RefSeq) GD24321 gene product from transcript GD24321-RA
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dsi  Drosophila simulans
Pathway
dsi00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dsimw501_GD24321 (Dsim_GD24321)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dsimw501_GD24321 (Dsim_GD24321)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 6733076
NCBI-ProteinID: XP_002080153
UniProt: B4Q4E1
Position
2L
AA seq 913 aa AA seqDB search
MALKMRIAIIGQSNFAADVLELLLDRPNIQIVGVFTIPDRGSREDILATTAIIHNIPVFK
FACWRRKGVALPEVLEQYKSVGATLNVLPFCSQFIPMEVIDGALLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDTIYKRFLYPEGVKA
MGVAVDMVASGVAPKIIQAEVGATYDPAMFKTENQVINLQATAEKIWNFVRGLDSVPGAI
ATVLHENGTEEQIRLFGAHLYSAGPVSNGKALRLRGLTKTAWIHSGGLLIEGTDGVFVNI
RRIKRDTKVINASEWFKQAEDQSITDFSEDELVKRSLVAGIWKAILKEDVDSSTDFFASG
AGSMDVVRLVEEVKETFDVPLQNEQVFMAPVFEEFFSLLVRFLRQGSACSDDQQLNFQAF
TLKANKREIRVPTQLFINGEFVDSDSQRTLEIVNPTNEEVICKVACASATDVDKAVQAAH
SAFYGSWRQITPRQRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVRAGFPPGVINVLPGKGSDAGQAVADHELVRKLGFTG
STPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDMDKAVRHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGA
KLVYGGCRVPHLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFNGSDVDSLMQRANR
TEYGLASGVFTKDIGKALNFADRIEAGTVFVNLYNKTDVAAPFGGFKQSGYGKDLGQEAL
NEYLKTKCVTVEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaaatgagaatcgcaattataggacagagcaattttgctgctgatgttctg
gagcttctgttggatcgcccaaatatccaaattgtaggagtcttcactattccagataga
ggcagtcgagaggacattttggccactactgctatcatccacaatatacctgttttcaag
ttcgcatgctggcgtcgcaagggcgtggcactacctgaggtcttggaacaatacaagtcc
gtgggggctaccctgaatgtgttgcccttctgttctcaattcattcccatggaggtgatt
gacggggcgctattgggcagcatttgttaccacccgtctattctcccacgtcaccgcgga
gctagtgctatatcgtggacactgatcgaaggggacgaggtggccggcttcagcatcttt
tgggcagatgacggtcttgacacaggacccctgctgctaacccgacaaacaaacctggaa
cccacggacacgctggacaccatatacaagcgctttttgtaccccgaaggtgtaaaggcg
atgggtgtcgccgtggacatggtcgctagtggtgtggcacccaagataatccaggcggaa
gtgggggcaacctacgacccggctatgtttaaaacagaaaatcaggttatcaaccttcag
gctacagcagaaaaaatttggaactttgttcgtggtctggactcagttcctggagccata
gcaacggttctacatgagaatggcacagaggagcaaattcgactatttggtgctcatttg
tactctgctggccccgtgtcaaatggaaaagctctacgtctaaggggcctaacaaagacc
gcctggatacacagcggtggtcttcttatagagggaaccgacggtgtctttgtcaacata
cgccgcattaagcgtgacacaaaggtaataaatgccagcgagtggtttaagcaagctgag
gaccagtctatcactgacttcagcgaggacgaattggtaaagcgatcgttggtggccgga
atttggaaggcaatacttaaggaagatgtcgactcatcgactgatttctttgcatccgga
gctggttcaatggacgtggtacgcttagtcgaggaagttaaagaaacctttgacgtgccg
ctgcagaacgagcaagttttcatggcgcctgtgtttgaggaattctttagcctgctggtt
aggttccttcgacagggaagtgcctgttccgatgaccagcagctcaactttcaggcattc
acgctgaaagccaacaaaagagagattcgagtgcccacacaactttttataaacggagag
tttgttgactccgattctcaacgcactttggaaattgttaaccccactaatgaggaagtg
atttgtaaagtggcatgcgcctcggccaccgacgtggacaaggcagtgcaagcagcccat
tctgccttttatggatcttggaggcagataacacccagacaacgaggccagttgatgctc
aatttggctgatctgatggaacgcaataaggaggagctggccacaattgagtcagtcgat
tcgggagcggtttacactctagcccttaaaacccacgttggaatgtccatcgaagcgtgg
cgctactttgccggatggtgcgacaagatccagggcaacacaatccctgttaaccctgcg
agacccaacaacgtactgaccttcacccgtaaggagccaattggtgtgtgcggtttaata
acgccttggaactaccctctgatgatgctttcatggaaaatggccgcctgcattgccgcc
gggaatacctgtctcataaagcctgctcagacctgccccctgaccgctctaaagtttgca
gagctaactgtccgagccggattcccccccggcgtgatcaatgtcctgcctggaaaaggt
tcagatgcgggccaggcagtggcagatcatgagctggtccgcaaactggggtttaccggg
tccacacccattggcaagcacattatgaagtcatgcgcagactccaaccttaaaaagtgc
tccctggagctgggcggcaagagcccgcttattatctttgcagattgtgatatggacaaa
gccgtcagacacggcatgtcctcggtgttttttaataaaggagagaactgcatcgccgcg
ggacggcttttcgtggaggatcggatacatgatgaatttatccgacgcgttcttaaggat
ctgcgcaccatgaccatcggggacccgcttgaccgctcgacggcccacgggcctcagaac
cacaaggcgcactttgacaaacttctggagttttgtagacgtggggtagacgagggcgcg
aagctggtgtacgggggatgtcgagtcccacaccttaagggatatttctttactcccaca
gtgttcacgaacgttacggacgatatgttcattgcccaagaggagtcctttggaccgatt
atgataatatccaagttcaacggcagcgatgtagattccttgatgcagcgggctaatcgc
acggagtatggcttggccagtggcgttttcacaaaggatattggcaaagcgcttaacttt
gctgatcgcattgaggccggcactgtgttcgtcaatttatacaataagactgatgtggca
gctccatttggtggctttaagcagagcggttatggcaaggacttggggcaggaggcgctc
aacgagtaccttaagaccaagtgtgtcacagttgaatattag

DBGET integrated database retrieval system