KEGG   Drosophila simulans: Dsim_GD24368Help
Entry
Dsim_GD24368      CDS       T01065                                 

Gene name
Dsim_unc-13
Definition
GD24368 gene product from transcript GD24368-RA
Orthology
K15293  
protein unc-13
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 1194 aa AA seqDB search
MAATKRNAGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCY
ECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMK
DRMKQREREKPEIFELIRAVFSVEEKSHTGHMKAVKQSVLDGTSKWSAKIAITVICAQGL
IAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDND
LKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKG
EEKVAPYHVQYTCLHENLFHYLCEENTGMVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRY
GIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAASNFG
KEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSP
PRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHK
LIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHRLCKS
SAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKR
DKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLI
AYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQN
LNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVEADEV
LRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTD
NAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDT
IKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLENSEES
VGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKF
ATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISE
KGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEPTMGT
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggccgctacaaaacgaaatgctggactcacatctgctgttccacgtgcaacgctgaat
gacgaagatctgaaaatgcacgtgtacaaaaaagctctacaagccctgatataccctata
tcctcaacaactccccataattttttgttatggactgccacgtcaccaacgtactgctac
gagtgtgagggtcttttgtggggaatagcacgacaaggggtgcgatgcactgagtgcggt
gtaaagtgtcatgaaaagtgtaaggacctgctgaatgcggactgcctgcagcgtgccgct
gaaaagagctcaaagcacggcgcggaagacaaggctaactcgattattacagcgatgaaa
gatcgtatgaagcaacgtgaacgagagaagccggaaatttttgagttgattagagccgta
ttcagcgttgaggagaagagtcataccggtcatatgaaggctgtgaagcaaagcgtcctg
gatggtacaagcaagtggtcggccaaaatagcaatcacagtgatttgtgctcaaggcctg
atagcgaaggataaaagcggtaccagtgatccatatgtgacggtgcaggttagcaaggtg
aaaaaacgaacgcgaacaatgccgcaggaacttaaccctgtgtggaacgagaagtttcac
ttcgagtgtcacaactcctctgaccgcattaaagttcgtgtttgggacgaagacaatgac
ctaaagtcgaagctgcgtcagaagttaactcgagagtcggacgactttttgggacaaaca
attatcgaggttcgtactctttccggtgaaatggatgtatggtacaacttggagaagcgc
acagataaatcggccgtgtcaggcgcgatacggcttcacatatctgttgaaataaagggc
gaggaaaaagtagctccttaccatgtacaatatacctgtttacacgagaacctctttcat
tatctttgtgaagaaaatactggaatggtcaagttgccaactcaaaaaggggacgatgct
tggaagttgtattttgatgaaatacccgaagagattgtcgacgagttttctatgcgttat
ggaattgagaatatttatcaagctatgacacatttccactgcttatccgctaaataccta
tgtcctggggtgcccgctgtaatgagtaccctattggcaaacataaatgcttattatgct
catacgactgcttcgtcagctgtatcggccagtgatagatttgctgccagcaattttggg
aaagaaaaatttgttaagttgctggaccagttgcacaactcactgaggatcgatttgtca
atgtacagaaataactttcctgcatcgagtccagaaaagctaatggatctaaaatctaca
gtcgatttattgaccagcataacatttttccgcatgaaggtacaagagctatccagcccg
ccgagagcaagtacagtagtcaaggattgtgttaaagcatgccttagatccacttatcaa
tttttatttgaaaattgttatgaactctacaacagagaatttcaggttgatcccaacgaa
gcaaaacgtgccccagatgatcatgaacccaagcttgatagcgtcgacttttggcataag
ctaatagctttaatcgtatcggtaatagatgaagacaaaaacagttacggaacggtttta
aatcaatttccccaagagctaaatattggacagttatcagcatcttcaatgtggcatctc
tttgctgtggacatgaagtacgccctcgaggagcatgagcagcatcgtctgtgcaagtca
tcggcttatatgaaccttcattttcgagttaagtggctatatagtaactacgtcaaagag
gtgcctccctacaaaggagcggttcccgattacccagcatggttcgagccttttgtgatg
cagtggctgaatgaaaatgacgatgtgtcattggaataccttcatggcgcatttaagagg
gataaaaaagacgggtttcaaaagagcagcgagcacgcgcttttttcaaattctgtagtc
gacgtttttacgcaattgacgcaatgtttcgatgttgttagcaaactcgagtgtcctgat
ccagaaatttggaaacgttacatgaggcgttttgctaaaacaatcgtaaaagtgctaata
gcctatgcggatattgtgaaacttgagtttccagagcatatgaaggatgaaagaattgct
tgcatacttatgaacaacattcagcaactaagggtgcagctagaaaaaatgtttgagtct
atgggtggggataagctagaggaagatgcagccaatattttgaaagaactacagcaaaat
cttaactctgcgttggacgacttagcttcacaattcgctatcagtttggagccacgaata
actcaatcagtgcgagaacttggagacatgctgctttctattaagggaggcagtggaacc
cttgctgctggtaatcttgcagctcaaaggaacgcggtcgccgttgaggccgatgaagtt
ttaaggccgcttatggatttacttgatggctctttaactctctatgcgcaatcatgtgaa
aaaaccgtgctaaagaggttactaaaggagttatggaagatcgtaatgcgaatattagag
aaaacaattgttttaccacctatgactgataaaactatgatgtttaaacaccttactgac
aatgcaaaaaacttggcatccaatgcaaaaattgaagacatgggtcgtttgttcaagtca
catatggcaggaaaacaggatgttaagagtgctctgagcggggtaatggacatatcaaaa
gaagttgaaaaaaacttgtcacccaagcaatgcgcagtgcttgacgttgcattagataca
ataaaacaatactttcacgcgggtggcaatggactgaaaaagacatttctcgaaaagtcg
cccgagcttcagagtttacgttacgcactcagtttatatacacaaatgaccgacacacta
atcaaaacctttatatctagccaagttcacgaagtcgatctagaaaactcagaggaaagt
gtcggggaaatatccgtacaaatagacttattttcccatccaggcaccggtgaacataaa
gtaaacgtgaaagttgttgcggctaatgaccttaaatggcaaataccatcgggtatgttc
agaccatttgttgacattaatttaataggaccgcacctgcaagaaaaaaaaagaaagttc
gctacaaagtcgaagtctaacaactggtcgcctaaatacaacgaatctttcagctttacc
attggaaatgaggagcagctggacttctttgaattgcacatttgcgttaaggactattgt
tttgctcgtgatgaccgacttgtaggcgtggctgtaattccattaaaagatatatcggaa
aagggatccgtcgcatgctggctacccttaatgagacgaattgaaatggacgaaacaggc
tggaccattttaagaattttgtcacagcgaaataatgatgaagtggccaaggaatttgtc
aagctgaaatcggaaatacggcaggagccaaccatgggcacataa

DBGET integrated database retrieval system