KEGG   Drosophila simulans: Dsim_GD24405Help
Entry
Dsim_GD24405      CDS       T01065                                 

Definition
GD24405 gene product from transcript GD24405-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dsim_GD24405
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dsim_GD24405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 411 aa AA seqDB search
VIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGE
NESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRG
KQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPPSS
SSGCGGVSGLCPSRNESPVTGQNRNFAAEITTSSTSATSISLTIKKENSHSSLRLHHGAV
AETDFKLKKSVPEGSSTATKEPMMNSDILLESFRQATVVSPRLPSKHSADSGGMSCLSAV
DVGPSRYYPYMNNNENNRLFSSSLNSSANSLSHLEQATKLDALGEYSATTPNLLSKNTGC
SFNSGSMNIDVAQESLVNIASNYALDKSIDIIGKSNVSLHTNKLKVQSNDM
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtaattgactttgggtcgtcttgcttcgagaaccagcgtatatacacatacatccagtca
cgtttttatcgcgctccagaggtaattttgggggggaaatatggcagagctatcgacatg
tggtcgttgggttgtattttagcagagctgctttcaggccatgcattgtttcctggtgaa
aacgaaagcgatcagttggcttgcattattgaagttttaggaatgcccaataaaaatata
ctagccagctcgaagaggtcaaaatcgtttttcagtccaaaggggtatcctcgatattgt
actgttcgaaccatgtctgatggaatggtggtcctaatcggcggacagtcacgtcgtgga
aaacaaagaggcccgccatgctcaaaaagcttatctaaggcgctggatggatgcaaagat
cccctctttcttaattttatacgtggttgccttgaatgggatgcagacaagcgattaaca
ccttcagaggctctaaaacatccatggcttcgccgtcgcttaccgagaccgccaagtagc
tcaagtggctgtggtggggtgagtggattatgtcctagtagaaacgaatccccagttaca
gggcaaaataggaacttcgcagcagaaataactacatcatcaacgtctgctacatctata
tctttaacgattaaaaaggaaaacagccattccagtcttcgtctccaccatggtgctgtt
gcagaaacggatttcaaacttaaaaaatccgttccagagggatcatcaaccgcaacaaaa
gaacctatgatgaacagtgatattcttctagaaagttttagacaagcaactgttgtatca
ccacgtttaccatcaaaacattctgctgactccggcggaatgagttgtcttagcgctgtg
gatgtggggccatcgagatattatccgtatatgaataacaatgaaaataacaggttattc
tcaagctcgttaaacagctcggccaactcattgtcacatttggagcaagccacaaaatta
gatgctttgggagaatactcggcgacaacaccaaatttactatcgaaaaatactggctgc
tcgtttaactcaggttctatgaacatcgatgttgcacaagagtctttggttaatatagct
agtaattacgcattggataagtctattgacattattggaaaatcaaatgtgtcgcttcat
acgaataaattaaaagtacaatcgaatgatatgtag

DBGET integrated database retrieval system