KEGG   Drosophila simulans: Dsimw501_GD24405Help
Entry
Dsimw501_GD24405  CDS       T01065                                 

Gene name
Dsim_GD24405
Definition
(RefSeq) GD24405 gene product from transcript GD24405-RE
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dsimw501_GD24405 (Dsim_GD24405)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dsimw501_GD24405 (Dsim_GD24405)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 779 aa AA seqDB search
MINQNSTHTGIAQNNPEKPNRHPYRDSGLQYFTRCFEPLAMINDSKEDLPTQPSNNIANY
TGDIQILPIFDCCEISESIQAISLPIVTSPSKTTDVPGLYLRTISENSKLKSEPECESLI
LVKESSAMENQTILFHEQIIMSGQQKCELQEKPKVLVVSPQQVMILYMNKLTPYERTEIL
TYPQIYFIGANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVI
KAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHT
CITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLK
QQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLS
GHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVL
IGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRR
RLPRPPSSSSGCGGVSGLCPSRNESPVTGQNRNFAAEITTSSTSATSISLTIKKENSHSS
LRLHHGAVAETDFKLKKSVPEGSSTATKEPMMNSDILLESFRQATVVSPRLPSKHSADSG
GMSCLSAVDVGPSRYYPYMNNNENNRLFSSSLNSSANSLSHLEQATKLDALGEYSATTPN
LLSKNTGCSFNSGSMNIDVAQESLVNIASNYALDKSIDIIGKSNVSLHTNKLKVQSNDM
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgattaaccaaaattccacacatactggtatcgctcaaaataatcctgaaaaaccaaat
cgtcatccatatcgggacagtggattacaatatttcacccgatgctttgaaccattggca
atgattaatgatagtaaagaagacttgcccacgcagccatcaaataatattgccaattac
actggagatattcaaattttacccattttcgattgctgcgaaatttcggagtctattcaa
gctatatcgttacccattgtaacatctccatcaaagacaacagatgttccggggttgtat
ttgcgtacgatttcggaaaattctaaattaaagtcggaacccgaatgtgaatcgctaatt
ttagtcaaagaatcttctgcaatggaaaaccaaacgattttatttcacgagcaaattatt
atgtctggccaacaaaaatgtgaattacaggagaaaccgaaggttctggtcgtttcccca
caacaagtaatgattttatatatgaataaactaactccatacgagcgaacagaaatacta
acttatccgcaaatatattttattggcgccaacgctaaaaagcgcccaggagtctatggc
ccaaataattctgaatacgacaatgaacaaggtgcttacatccatgtaccgcatgatcac
gtagcatatcggtatgaaatgttaaagataatcggaaaaggtagctttggacaggtcatt
aaagcgtatgatcataaaactcacgaacatgttgccttaaaaatagtgcgcaatgaaaag
cggtttcaccgccaggcccaagaggaaattcgcattcttcatcatttacggcgtcacgat
aaatataatactatgaacatcatacacatgtttgattactttactttccgcaatcataca
tgcattacatttgaactgctcagcataaatctttacgaattaattaagaaaaatggattt
aaaggcttcagtttgcagctggtgcgaaagtttgcacattctttgctacaatgtttggat
gcactttataaaaatgatattattcattgcgatatgaaaccagaaaatgttctactgaag
caacaaggacgttctggtataaaggtaattgactttgggtcgtcttgcttcgagaaccag
cgtatatacacatacatccagtcacgtttttatcgcgctccagaggtaattttggggggg
aaatatggcagagctatcgacatgtggtcgttgggttgtattttagcagagctgctttca
ggccatgcattgtttcctggtgaaaacgaaagcgatcagttggcttgcattattgaagtt
ttaggaatgcccaataaaaatatactagccagctcgaagaggtcaaaatcgtttttcagt
ccaaaggggtatcctcgatattgtactgttcgaaccatgtctgatggaatggtggtccta
atcggcggacagtcacgtcgtggaaaacaaagaggcccgccatgctcaaaaagcttatct
aaggcgctggatggatgcaaagatcccctctttcttaattttatacgtggttgccttgaa
tgggatgcagacaagcgattaacaccttcagaggctctaaaacatccatggcttcgccgt
cgcttaccgagaccgccaagtagctcaagtggctgtggtggggtgagtggattatgtcct
agtagaaacgaatccccagttacagggcaaaataggaacttcgcagcagaaataactaca
tcatcaacgtctgctacatctatatctttaacgattaaaaaggaaaacagccattccagt
cttcgtctccaccatggtgctgttgcagaaacggatttcaaacttaaaaaatccgttcca
gagggatcatcaaccgcaacaaaagaacctatgatgaacagtgatattcttctagaaagt
tttagacaagcaactgttgtatcaccacgtttaccatcaaaacattctgctgactccggc
ggaatgagttgtcttagcgctgtggatgtggggccatcgagatattatccgtatatgaat
aacaatgaaaataacaggttattctcaagctcgttaaacagctcggccaactcattgtca
catttggagcaagccacaaaattagatgctttgggagaatactcggcgacaacaccaaat
ttactatcgaaaaatactggctgctcgtttaactcaggttctatgaacatcgatgttgca
caagagtctttggttaatatagctagtaattacgcattggataagtctattgacattatt
ggaaaatcaaatgtgtcgcttcatacgaataaattaaaagtacaatcgaatgatatgtag

DBGET integrated database retrieval system