KEGG   Drosophila simulans: Dsimw501_GD24711Help
Entry
Dsimw501_GD24711  CDS       T01065                                 

Gene name
Dsim_GD24711
Definition
(RefSeq) GD24711 gene product from transcript GD24711-RB
  KO
K17610  
calcineurin B homologous protein 1
Organism
dsi  Drosophila simulans
Brite
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dsimw501_GD24711 (Dsim_GD24711)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 230 aa AA seqDB search
MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLN
PLHRQIIDLYCSSGTAPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLHLL
SKMFDTRRSGCITRSDFRQIMRCIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQA
FGLCCDHISYGEFEKRLLSADVDRRLSIAKWLEDDDEAEAGMGLPVGSGP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgggctcggtaggaagtcgtcagctcaaccccgtccaactgtgtgaccaccagcaggcc
acggggctgtccgcagagcagctagagcaactgcacacgcggttccgcagcctggatcgc
caccagcgcggctatttgacgcccaccgacttgctgcgcattccacagctatcgctcaac
ccgcttcaccgccagatcatcgacctctattgctcgtctggaacggcccccagccgtgac
cctagcgcgcgcatcggcttcaagcagttcgtggacacttgctccaccattttggtgcca
cagtttggccgcggctcagtgaggcgtcgcgacgggcgtgttcagaagcttcacctcctg
tccaagatgtttgacacacggcgcagcggctgcatcacacgctccgacttccgccagatc
atgcgttgcattgtcaatctggcctggagtcagcaacaggatcaggaacgtcaggagggg
ctttccgagaaccgtttgcctgaggtggaggccgaattgcaacttttagagcatcaggcc
tttggcctctgctgcgaccatatctcttatggggagttcgagaagcgcctgttgagtgcg
gacgtcgacagacggctgtcgatcgccaagtggctggaggacgatgacgaggccgaagcc
gggatgggactgccagttggctcaggcccataa

DBGET integrated database retrieval system