KEGG   Drosophila simulans: Dsim_GD24832Help
Entry
Dsim_GD24832      CDS       T01065                                 

Definition
GD24832 gene product from transcript GD24832-RA
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dsi  Drosophila simulans
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dsim_GD24832
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dsim_GD24832
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dsim_GD24832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 458 aa AA seqDB search
MQEGRLYGIDTMNFESLVSLINYYTRNPLYRNVKLSHPVSQELLRQALAEAAQGDHSGGH
DDNGASNYMGSNLEENVTCKALYSYKANKPDELSFPKHAIITNVQRDNSMWWIGDYGGMI
KKHLPANYVKVIDSTTEDYNSLNEEGTDGRTDSIEIFGAVASLFESNDPGIIFKLQIQTP
TMQNPFVIGFDNQETAYEWIKAIQEAALIASQLASQRRKKERTARVAKEMSDLIIYFRSV
PFREHSWIFQEMSSFPETKAEKQFFQQTHNSFSPTIAIRLAECQRLDSSNFNPMPFWNVG
SQMIALNYQTGDKAMQLNQAKFRNNGQCGYILKPSFMKLDSFNPNNPLCDGLSEVKVSIR
LIAARHLFRGGKSNNPQIVVELVGASFDTGVKYRTKVNENGFNPVWNESCEFNVRNPQFA
ILRFEVQDEDMFAETHFIAQACYPLTASPGLSQRHLAQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagggtcgtttgtacggcatcgatacgatgaactttgagtctctggtctcgctg
atcaactactatacgcgaaacccgctctatcgcaatgtcaagctcagccatccggtgtcg
caggagctgttgcgtcaggcgctggcagaggcggcccagggtgatcacagtggcggccac
gacgacaacggtgcctccaactacatgggctccaatctggaggagaatgtcacgtgcaag
gcgctctacagctataaggcgaacaagccagacgaactctcttttcccaagcacgccatc
ataacgaatgtccagcgggacaactcgatgtggtggattggggattacggtggcatgatc
aagaagcatctgccggctaactacgtaaaggttatcgattcaaccaccgaggactacaac
tcgctgaacgaagagggcacggatggacgcaccgattccattgagattttcggtgcggtt
gcctcgctctttgagtccaacgatccggggatcatcttcaagctgcagatacaaacgcca
acgatgcagaatccgtttgtgattggcttcgacaaccaggagacggcgtacgagtggata
aaggcgatccaggaggcggccctcatcgccagccagctggcatcgcagaggcggaaaaag
gagcgcactgcccgggtggccaaggagatgtccgacctgattatctacttccgcagcgtg
ccgttccgcgagcattcgtggatatttcaggaaatgtcgagtttccccgaaacgaaggcc
gagaagcagttcttccagcagacgcacaactctttctctcctaccatcgcaatcagatta
gccgagtgtcagcgcttggactcgtcgaactttaaccccatgccattctggaatgttgga
tcccagatgatcgcactgaactatcagacaggcgataaggccatgcagctgaatcaggcc
aaattccgaaataatggacaatgcggctatatcttaaagccgtcgtttatgaaattggac
agcttcaatccgaacaatccgctgtgcgatggcctgagcgaggttaaagttagcatacgt
ctaatagccgcacgtcatctattccggggcggcaaatcgaacaatccgcagatcgtggtc
gaattggttggcgctagctttgatacgggcgttaagtaccgcaccaaagtcaatgagaat
ggcttcaatccggtgtggaatgaatcgtgcgagttcaacgtgcgcaatccacagttcgcg
atcctgcgcttcgaagtgcaggacgaggatatgttcgccgagacgcacttcatcgcccag
gcgtgctatccgttgactgcatcgccagggctatcgcagcgtcatcttgcgcaataa

DBGET integrated database retrieval system