KEGG   Drosophila simulans: Dsim_GD24925Help
Entry
Dsim_GD24925      CDS       T01065                                 

Gene name
Dsim_ST6Gal
Definition
Sialyltransferase
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dsi  Drosophila simulans
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dsim_GD24925 (Dsim_ST6Gal)
   00514 Other types of O-glycan biosynthesis
    Dsim_GD24925 (Dsim_ST6Gal)
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     Dsim_GD24925 (Dsim_ST6Gal)
Glycosyltransferases [BR:dsi01003]
 Terminal extension
  Sialyltransferase
   Dsim_GD24925 (Dsim_ST6Gal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 449 aa AA seqDB search
MRQVTRASSGQSQALLSCLIIAVCAALIIQAGQIQGAKAQPGREPGEVNSPGNGNGTTGH
RVPRSVFHVRWNPNEKFIVESRENPAINSSKLAPHPRLKVSKNTKLTLSPKLYLCHDKHS
ELCHNKTQQFRQRIVRAFEKAMVESVNESQANHYNVDYKPVFGDSFEEQYYPSTCLVMEA
GVRVLRRKDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIV
MRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTLE
DWLTSADYDLFTNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPISRNPPSSGFI
GLALLLPHCPQVDFVEYVPSTRLNGRCHYYSKEMNSACTFGSWHPLAAEKLMALDMNMAE
DDDMSVFQFGILRIRRPDKLLCGFNFFGY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaagtgacacgcgcatcgtcgggtcaaagtcaggccctcctttcatgcctcatt
atcgccgtgtgcgccgcattaataattcaagctgggcaaatccagggtgcgaaagctcag
ccgggacgcgaacccggcgaggtgaattcgcccggtaacggaaatgggaccactggccac
cgcgtgccgcgcagtgtgttccacgtgcggtggaatcccaacgagaagttcatcgtggag
agtcgcgagaacccggccatcaactcctccaagctggctccgcatccccgactcaaggtc
tccaagaacaccaagctcacgctgagccccaagctgtatctctgccacgacaagcactcg
gagctgtgccacaacaagacccagcagttccgccagcgcattgtccgggccttcgagaag
gccatggtggagtcggtaaacgagtcgcaggcgaaccactacaacgtggactacaagccc
gtcttcggggacagcttcgaggagcagtactacccctcgacctgcctggtcatggaggcg
ggcgtgcgggtcctgcgccgcaaggacgcgcccttcaacaagctgcccttcggccgactc
ttcccgcgccagaagctcttccgcaacgtcaaggacatcaagacctgtgccatcgtctcc
agcgcgggatccttggctggctccaagttaggccgcttcatcgacacgcacgacattgtg
atgagattcaatcatgcgcccacgcaaggacacgaggtggatgttggcagcaaaaccacg
atccgtgtggtgaattcgcaagtggtcaccaagccggaattcgacttcacccgggccccc
atcttccggaacgtcacgatcgccgcctgggatccgggcaagtacaatggcacgctggag
gattggctcaccagcgctgactacgacctcttcaccaactacgagctgtacaggcggcgc
tatcccaagtcgcgcgccttcctcatcgatccccactccgtgtggcgcctgtggcagagt
ctgcagatgtttgccggaaaccggccgataagcaggaacccccccagttccggtttcata
ggactggccctgctcctgccgcactgtccccaggtggacttcgtggagtacgtgccgtcc
acacgactcaatggacgctgtcactactacagcaaagagatgaattccgcctgcacattc
ggctcctggcatccgctggccgccgagaagctgatggccctggacatgaacatggcggag
gacgacgacatgtcggtcttccagttcggcatcctgcggatacgcaggccggacaagctg
ctctgcggcttcaacttctttggctactga

DBGET integrated database retrieval system