KEGG   Drosophila simulans: Dsimw501_GD25106Help
Entry
Dsimw501_GD25106  CDS       T01065                                 

Gene name
Dsim_GD25106
Definition
(RefSeq) GD25106 gene product from transcript GD25106-RB
  KO
K04437  
filamin
Organism
dsi  Drosophila simulans
Brite
Cytoskeleton proteins [BR:dsi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dsimw501_GD25106 (Dsim_GD25106)
  Intermediate filaments
   Intermediate filament-binding proteins
    Dsimw501_GD25106 (Dsim_GD25106)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsimw501_GD25106 (Dsim_GD25106)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 2990 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNSDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIVNGNIKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCRITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTQAMDLAQRE
FGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDPVKNFTTDWN
DGRVMCEIIKGLGGSAPAPEKLSTDPFHYENNIRKAVDAGARLGVQPILTAKDMANPEVE
HLGIMAYAAHLQWVPPRPPLSDLVSVYLESTSGRVGEPTHFRIDVMSRDISLSSVRCHVV
PPSGQPGQPVRLNAHGEGVFVPERYGMHEIVVEIGEDSLGGHFFRALPRLLQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVSGELHVDIVHDK
HSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHDSKHRSESPSMHFVSTTNTRHNDYRNSSLSRHNTAERTNSYSPQYSPKLDTTDYHSSS
SRYYKRESEENHATPPPAPPPASGSPTVKYLNSADLYTETLNGRRDSKTSNSSSTKNDYY
YDKENELYSQRRAVTKPKLTPPREERELTSTTNTSSSSSFQQRHQQLATSTLTRSLSPIP
SPTLNTRSSEVHTHSPLTIKTSNQYESSTRNITSSPRHASVSPVQRYSPNSAYITTATHR
MGSPLTSPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTAERLRRTGSPEPR
IDHSSNVRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTEKQLNTELQYNRPDLD
HETHRNTQYNKFALHKQQQQQSDYRRDSPDDAERYKPSAITVKSHSNNTYTDKSGGYTKT
VKESSEHVVTESNGHGPSPGYGYSSLSRFRPIDGNATGARAIRVQDIPNGSIGRPVEFEI
DGSRAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITFNGETVPGSPWH
AEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSKSKLNARVTH
EAANGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVNGGVVGQPCQ
FRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGETVRGC
PFVCAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPQGELPVRVTGD
IHAGFTAEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRGTMGRPVQFT
VDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVSFNKMPVPGC
PITVSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGPAGQSVPAQVHQS
ADGVFKAEFVPRVVGEHRVNVTVNGLPTAGSPYAAKVYDVSAIKVKNVSSGTVGKAVTFL
VETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAESHTVELRFNSQDVPGSPF
TCRVAAAARIQSPETMDKVSVGRLFEFVVESDTKPTVEVLGPARRSVPVKIDALGTSTLG
YNVKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSAEKVIVTDIRAGVVNKSVSFGINA
SQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKPTEAATHSLSVRFNGHPVPGSPFS
CHIAAAAASPSMGLPRAMAMGECLKQAAVKMDNTFELEGFEGVEPQIFVTSPAGDNEHCQ
LSQHDGGSYSASFRPTTVGRHLISVTANDQHINGSPFSCNVFDVSRVSISGLEQQYGPAN
LGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACARGLYDVTFVPQSTEPHYVNITF
NEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPSDDQIVEIFSPDQKSVPYSINRQTAEFR
THMTGNYTLRFIDRETRQHIGSRTLCVFDPTLVKITEVSEAFCHRPASIGVSLNEAGQGD
LSALVRCGATEVPHTIRGPSKTGVYEIVYQPTRVAPHKISILFNEVPISLKPLEINVLPA
SAGKEISVSGLGLYQSRVGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVRCYQTKNGHL
QAEFTINKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVSTQGVTKEPLALHSPNSFTVRT
DNAGTAELEAFAISPSNQSIPVLISEQSDGVYNVEFVPSQPGNYKLTLMYGGETIPSSPL
TFTASSSGVRNDARAAGHGLEVCHRNKEASFVVYCPIAPNVQIERLDEYGERIEPKIKAL
GNNEWRISYTILSVGKYEIRASCPNRGSLPGSPWHISCVESNKVTPVGGWGTLVDHDGRL
ILPARIIFDVENAGPGKLVCSIDGIEIPVDKLVDGKMCLNITGENLAAGEHDLDLTWSGL
TITQCPRSAFVTGQQAADKVQLMGRGLAAAQAGEAAHFTIDASNAPAGRPEVILTSQDNT
SLPVSLAQPRPSENIWLASYTPLKSTTGTLNLSVKWNGRLVKGCPLTVAVGSSMDASKVI
VSGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGVRKVAYCELYDHGDATFTLNIKPQE
SGRHILTIKYGGQNVPGSPFALKVAGAPDASKVRVYGPGIEHGVLATFQSRFICDTRGAG
AGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGEFVPGSPFPVM
IFDTEEELRRYLQGIXGQLNHHVIVFPSGLSPLPIRRDQSRRRASICSPL
NT seq 8973 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaggacataaaaggcgccaaggtgacgcatgcggggctgctcaagcacaac
tccgatggcaccaccgaaacgcagaagatcacccacgccggtctggtggcccggagtccc
gagggcaccgccgccaagggtatgaacatccggggcaacgaggacctctgggtggagatc
caggcgaacacattccgcaactgggtcaacgagcatttgcgcgagacgggaatgcaggtt
catgactgggccaccgatttctgcgatggcacatgtctgtgcgcccttgtggagaacctg
cagacgcgtccactgaaaccctcgtggaatcgccgacccgccaaccagcatcattatttg
gagaacgccaccactgcgctgaagtccatcgaggcggaccacatcaagctggtgaacatc
ggcaacgtggacatcgtgaatgggaacataaagctgatcctgggactgatctggtccctc
atcgtgcgctaccagatcggaaggagcaagttcccgccgcgcaaactgatgctggcctgg
ctgcaggccgctctgccggactgcaggatcaccaatctgaccaccgattggaatagtggc
gtcaatctggcggcgctcctggactactgccagccgggcttgttcccgcactggcggagt
ctcgatcccagccagagtgtgcgcaactgcacccaggccatggacttggcccagcgcgag
tttggagtgcccaaggttctggagccggagtacctggcctcaccctggttggatgagctg
tccggcatgacgtacctctcgtacttcatgaagcccggtggtcctggttacaatgccacc
atgcgatgggtgaatacgcaggtcaaggaccctgtgaagaactttacgaccgactggaac
gatggacgcgttatgtgcgaaattattaagggactgggtggctcggcgcccgctccggaa
aagctcagcaccgatcccttccactacgagaacaacattcggaaggcggtggacgcgggc
gcccggctgggcgtgcagcccatcctgacggccaaggacatggccaacccggaagtggag
cacctgggcatcatggcctacgcggcccacctgcagtgggtgccgccgaggcctccgctg
tccgacctggtcagcgtctacctggagagcacatccggtcgggtgggcgaaccgacccac
ttccgcatcgacgtaatgtcccgggacataagcctcagctcagtacgctgccacgtggtt
cctccgtccggacaaccgggacagcccgtgcggctcaatgcccacggcgaaggagtcttt
gtgccggagcgctatgggatgcacgagattgtggtggagatcggcgaggacagcctgggc
ggacacttcttccgagccctgccgcgtttgctgcaggtggctccgccgggaatggcgccc
tgtgccttgggcagtctcgtcgaggtgctggtcaatgccaccggtgcgcccaagacggag
gacatcctggtcacggcggtatcgcccacgggcatctcgcacaactgcccgctgaagaag
atcgacgagggacacagtgccatattcaagccggacgaggcaggtatctgggagatagcc
atcacctaccagggtcgccacatccaaggaggacccttcacctgtgccgtgtttgatgca
tccggagtctcggtccatggtttggatggagccatgccgctgagggcacacaccttcgaa
gtggatgcacgtggagtgggtgtttcgggcgagttgcacgtggacattgtccacgacaag
cattcgctggtctgctcggtggagaagatcgtggagaacaagtacagggtgacttttatg
cccaggcagaatggaaagtaccgggtgtacatctacttcaatggctacgatgtcaaaggt
tcgcctttcatcatgcgtgtgggcaccaagggaagatctggcaaaacgcgcagcagtccg
ctgcacgacagcaagcaccgctcggagagtccctcgatgcacttcgtctccaccacgaac
acgcggcacaatgattaccggaactcctcgctttcgaggcacaacacggccgagaggacc
aacagctactcgccccagtactcgcccaagttggacaccactgactaccacagttcgagt
tccaggtactataagcgggagagcgaggagaaccatgccactccgccaccagctccacca
ccagccagtggttcccccacggtcaagtacctaaactccgccgatctgtacacggaaact
ttgaacgggcgacgggattcgaagacctcgaacagcagctccacgaagaacgactactac
tacgacaaggagaacgagctgtacagccagaggcgtgcggtgaccaagcccaagttgacg
ccaccacgcgaggagcgcgagctgaccagcaccaccaataccagcagcagcagcagcttc
cagcagcgccaccagcagctggccaccagtaccctgacaagatcgcttagtccaatacct
agtcccacactcaatactcgatcaagcgaagtgcacacccacagtccgttgaccatcaag
acgtccaatcagtacgagagttccacgcggaatatcaccagcagtccgcggcacgcctcc
gtttcgcccgtgcaacgttattctcccaatagcgcctatatcaccacggccactcaccgc
atgggaagtccgttgaccagtcccgttagtaagaatggttacgagtcgtcgcgtaccgta
gaaaagtcatcgacctacaagtccacctcgaactacgtcaccgattcgaatattcgtgcc
agtccctcgctttacggaactgccgagcgactgcgtcgaactggatcccccgagccccgc
atcgaccactcctccaatgtgagggtgtcctcgatgaagccggcttccgccaggcgggac
agctgggacgtcatcaacaagacgaagcacatgctctcgcacaattcgctcgaatcgctg
gcgaacatgaccgagaagcagctgaacacggaactgcaatacaaccgcccggatttggac
cacgagacgcaccggaacacccagtacaacaagttcgccctgcacaagcagcagcagcag
cagtcggactatcgtcgggattcccccgatgatgcagagcgctacaaacccagtgccatt
acagtcaagtcacattcgaacaatacctatacggacaagtccggtggatatacgaaaacc
gttaaggaatccagcgagcatgtggttaccgagagcaatggacatggcccctccccgggc
tatggatacagctccctctctagatttcgtcccatagacggcaatgcaactggtgccagg
gccattcgagtgcaggatattccgaatggctctattggacggcccgtcgagttcgagatc
gatggctcgagggcgggctccggcaatctggagatcctggtcaacggcgggcgtgtcacc
tcctcggtgcgctcgctgggaggtcagaggttcatagccagctttacgccccacgaacat
ggaacgcacacggtgcagatcaccttcaatggcgaaacagttccaggttcaccgtggcac
gctgaaatcatgtcctcacccggcctgaccgctctgggcgaatccactcgcctggtaccc
gccaatacgccggcggtttttgagatactgccgcctcctggacaaagcctgagtaagggc
gagtgcgtggcgacggttttgactcctagcaagtcaaagctgaacgccagagtcacccac
gaggcggcaaatggtgctgctcgcatcgagttcgtgcccaccgaggtgggcacccacgtg
atcgatgcgtccatcaacggcacgaagatcgctggcggcccgctgatcgccaaggtctac
gactccagcctgatccaggtgacggaggtgaatggcggcgtggtcggccagccgtgccag
ttccgcgtggatgccagcgccgccggcgagggccagctggagatatccatcaacgagggc
gaggtgcccaatcatgtccaggtggtgggcggcggtcgctgcctggtctccttcacgccg
gagcaggccaagtcgcatctgattgacatcaaatttaacggagaaacggtgcgcggctgt
ccctttgtctgcgccgtggcggacacctcgcgagtgctcctgaatctctccaacctggag
ctaatcccagtcaaccggccctcctcctttcacatcaccgtgagcggaggtggagctgcc
gagctggctgtcagcgtgcgcggtccccagggcgagttacctgtccgggtgaccggagat
atccacgctggcttcacggccgagttcacgcccaccaccgttggcgggcactcgatcaac
gtggagtacaacggattcgccgtgcagggaacccccttcctggcgaagtcatacgatgcc
agcaaggtggtggtgggcagtgtctcgcggggaaccatgggacgcccggtgcagttcaca
gtggatgcgggcgatgccggtgagggcaacctggagatcacgatttcggccaagggacag
aacattcccacgcaggtgcatccgcaaggcagtgcaagattttcggtatcgtttgtgccc
acggagtcgtgcgagcacacgatcaacgtgtcattcaacaaaatgcccgttcccggctgt
ccgataacggtcagcatcagtgggggcgtggccgggccccaggtgtccctgggtggccca
ggacccgtgcaccagaccaattcttttgtaatcaatcacaatggcggccgtttggaggac
atcgaggtgaacgtggaaggacctgctggccaatcggttccggcgcaagtgcatcagtcc
gcagatggcgtcttcaaggcggagttcgtgcccagagtcgtgggtgagcaccgggttaat
gtcacggtcaacggattacccaccgccggaagtccatatgcagccaaggtctacgatgtc
agcgccatcaaggtgaagaatgtgagtagtggcactgtgggcaaggctgtcacattcctc
gtggagacgtcccaggctggccccggaaacctagaggtgaccgtcaacggaggcagggtt
ccaacttcagcccaagcccagggtcagcacacctatgccatcagcttcactccccgcgag
gctgagagtcacacggtggagctgcgcttcaatagccaggatgttccgggatccccgttc
acttgccgtgtggctgctgccgctcgtatccaatcgccggagaccatggacaaggtcagc
gtgggacgactgttcgagttcgtggtggagtcggacacaaagccgacggttgaggtactc
ggtcctgccaggcgtagtgtgcccgtgaagatcgacgcattgggtacctccaccctgggc
tacaatgtcaagtttgagcccatggaagtaggcgatcactcggtggaggttcgtctgccc
ggtggtggtcacgtggagggcagtccgttcctactgaaggcctactccgccgagaaggtt
atagtcaccgatatccgtgctggcgtggtcaacaagagtgtgagcttcgggatcaatgcc
tcgcaggcaggagccggcaacctggagataattgtggccgtcaatggcaagaacgtgccc
aactttgtccaatcggagggcaatgctcggttcaaggtgaacttcaagcccacggaggcg
gccacccactcgctgtcggtgcgattcaatggacatccggtgccgggctcaccatttagc
tgtcacatcgccgctgccgcggcttcgccctcgatgggattgccacgggccatggccatg
ggagaatgcctgaagcaagctgccgtcaagatggacaacacctttgagctcgaaggcttt
gagggcgtggagcctcagatctttgtgacctcgccagcaggggacaatgagcactgccag
ttgagtcagcacgacgggggtagttactccgcttcgttccgccccaccactgtgggtcgc
cacctgatcagtgtgacagccaacgatcagcacatcaacggatcaccctttagttgcaac
gtgttcgacgtctccagggtgagcattagtggactggaacagcagtatgggccagccaac
ctgggcgttccagttaccttcagcgttgacgccgcaggagctggtgaaggaaccctggag
ctggtggtttccacggacagcagcaccgttaaggcagaggtggtggcctgtgcccgcggt
ctgtacgatgtgaccttcgtgccccagagcaccgaaccccactacgtgaacatcactttc
aacgaggtggccgtggacggaagccccttccgcgtggacatccagcagcacacgcagcat
attcagatcggtagtttggcggccattgatttcccatcggacgatcagatcgttgagata
ttctcgccggatcagaagtctgttccgtattcgattaaccggcaaacagccgagttccgg
acccacatgaccgggaactacactttgcgattcattgatcgcgagacccgtcagcacatt
ggatcccgcacgttgtgcgtctttgatcccacgctggtgaagatcactgaggtgagcgag
gccttctgccatcgtccagccagcattggcgtgtccttgaacgaagctgggcagggagac
ctttcggctttggtgcgttgtggcgccaccgaagtaccccacaccattcgcggacctagc
aagacgggagtatatgagatagtttaccagcccacgcgtgttgctcctcacaagatcagc
attctcttcaacgaagtgcccatttccctgaaacccctggagatcaatgtcctgcccgcc
agtgctggcaaagaaatcagtgtcagtggtctgggattgtatcaatcgcgagtgggaaag
accacttcctttgccatcgatacagtcaagaggccagctagggagttcgatgtggtggtc
tccggaccaggaggacaagctcttccggtcagatgttatcagacaaagaacggacacctg
caggcggagttcaccatcaacaagccgggacagtgtgtcattgaggtactccaccaatcg
aagcctctgcccggaagcccatttacgtgtgaatcctttgacagcagcaaagtcagcacc
caaggggtcactaaggaaccactggcccttcacagtccaaacagtttcacagtacgcacg
gataatgccggaaccgccgaactggaggcgttcgccatatcgccaagcaatcagagcatt
cccgttctaattagcgagcaatctgatggagtctacaacgtggagtttgtgccctcgcag
ccgggcaactacaagctgaccctcatgtacggaggcgagacgattcctagttctccactg
acctttaccgcctcgtccagtggcgtaaggaatgatgcccgtgccgccggacacggactg
gaggtttgccacaggaacaaggaggcatcctttgttgtctactgccccattgccccgaac
gtccagatcgaacgattggatgagtatggcgagcggatagagccgaagatcaaggctctg
ggcaacaatgagtggcgcatctcctacacaattctgtcagtgggcaaatacgagatcaga
gctagctgtccaaacaggggaagcttgccgggatcgccgtggcacatcagttgcgtggaa
tccaacaaggttacacccgtaggtggctggggtactctcgtagatcacgacggccgtctg
attctgcccgcgcgaattattttcgacgtggaaaatgctggaccgggaaaactggtttgc
agcatcgatggcatcgaaataccggtggacaagttggtcgacggcaagatgtgcctgaac
atcaccggcgagaacctggctgccggcgagcatgacttggatttgacttggagcggctta
accatcacccagtgccccaggagtgccttcgtcacaggtcaacaggcggcggataaggtt
cagctcatgggtcggggtctggctgcagctcaagctggggaggcagcacacttcacaatc
gatgcctccaatgcgccggctggcagaccggaggtgatcctcaccagccaggacaacacg
tcgctgccagtgagcttggcgcaaccgaggccaagcgaaaacatctggctagcctcctac
actccactgaaatccacaactggcactctaaatctctctgtaaagtggaacggtcgtttg
gtcaagggatgtccgctaacggtggcagtgggctcttcaatggatgcctcaaaggtcata
gtctccggcgagggactgcgtcacggtattgtgggcaaggatattaagtcttggatagac
accaggagagcaggacccggcgaactcaccgcccattgtgctggtgtacggaaagttgcc
tactgcgaactatacgatcatggagatgcaactttcaccctgaacatcaagccccaggaa
tcaggtcgccatatcctgaccatcaagtacggaggacaaaatgttcccggctcgccattc
gcactgaaagtggccggtgcaccggatgctagtaaggtccgcgtttatggacctggaatc
gagcatggcgtgctggccaccttccagtcgcgcttcatctgcgacactcgcggagcggga
gctggtcaactgacagttagggtccgtggacccaaaggagctttccgcgtggagatgcag
cgagagagtcagaaagatcgcaccatactgtgcaagtacgatccaaccgaaccgggcgac
tatcgagtggaggtcaaatgggcaggcgaattcgtgccaggatcgccgttccccgtcatg
atcttcgacactgaggaggagttacgaaggtacttacagggcatatgaggccagctcaac
caccatgtcattgtcttccccagtggccttagtccactacccattaggcgcgatcaatcc
cgacgccgtgcctccatttgttctcccctctag

DBGET integrated database retrieval system