KEGG   Drosophila simulans: Dsimw501_GD25137Help
Entry
Dsimw501_GD25137  CDS       T01065                                 

Gene name
Dsim_GD25137
Definition
(RefSeq) GD25137 gene product from transcript GD25137-RB (EC:3.1.3.- 3.1.3.41)
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dsi  Drosophila simulans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsimw501_GD25137 (Dsim_GD25137)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dsimw501_GD25137 (Dsim_GD25137)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsimw501_GD25137 (Dsim_GD25137)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dsi00537]
 Enzymes
  Dsimw501_GD25137 (Dsim_GD25137)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 579 aa AA seqDB search
MLDIADLKKDTTFQTRYAQRTINLNLGNFVWKHSNPPHTHFAEQLDMGSSQRQLVLPFLL
LLALAGTALSGVQEVHNVLELTGRAVNKVRFSTDVASDKYTPPEEMDPQYWYNIADEEIT
KRLQLPQPNSQKAKNIIMFLGDGMPLATVAAARILKGQRQGNTGEESSLSFERFPYTGLS
RTYCSNSQVPDSACTATAYLCGVKTNIVNIGVSAAVEYNNCSASQDPANRLTSIAEWAQN
AGKSTGIVTTTTLTHASPSGAYAKTANRMWECDTDVTNYGEDASSCIDMATQLVTQTPGK
NFEVMFGGGMGKFLPNSIVDSHGKPGERSDGVNLLSRWQGLHDGGVLVTNRNQLLNLNVS
AVSSVIGLFQSQLMNFHLEADDTYQPTLSELTEVTIKKLSQNKENGYFAFIEGGLIDYGN
HYTKAGYALDEALEFEKAIQLARDMTDIEDTLIVVTADHGHAVSIAGYPGRGTPILGINQ
HDTDINGVKYSVLNYAAGPNQYLDETGQRIPLDDILGSDDAITPSYISKDQGVHSGEDVG
IFASGPQSHLFTGVMQQSTIPHLMAYAACIGSGKQVCDN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgctagacatagctgatctaaagaaagatacgacattccagacgagatatgcccagagg
accataaacctaaatttaggcaactttgtctggaagcacagtaatccgccgcacacgcat
tttgcagagcaattagatatgggttcctcccagcggcagttagtactcccattcctgctc
cttctggcattggccggaacagcactgagtggtgtacaggaggtccacaacgttctggag
ttgacaggacgggcagtgaataaggtcaggttttccacggatgtggcttcggacaagtac
actccaccggaggagatggatccccagtactggtacaacatcgccgacgaggagatcacc
aagaggctgcaactaccacaacccaattcccagaaggcaaagaacatcattatgttcctc
ggagatggcatgccactcgccaccgttgcagctgctcgcatcctgaaaggacaacgccaa
ggaaacaccggtgaggagtcctccctgagcttcgagcgattcccctacactggtttgagc
aggacctactgctccaattcccaagtgcccgactccgcctgcactgccacggcgtatttg
tgcggcgtaaagaccaacatcgtcaatatcggagtaagtgcagcagtggaatacaataac
tgcagcgccagtcaggatcccgcgaaccgcctgacctccatcgccgagtgggcccaaaac
gctggaaagtccacgggtattgtgaccaccaccacactgacccatgccagtccctcggga
gcatatgcaaagacagccaaccgcatgtgggagtgcgacacagatgtgaccaactatggt
gaggatgccagctcctgcatcgacatggccacccagctggttacccagacgcccggcaag
aacttcgaggttatgttcggcggaggaatgggcaagttcctccccaactccatcgttgat
tctcacggaaagcctggtgagcggtccgacggagtgaatctgctctcccgctggcaggga
ctccacgatggaggcgtcttggtcaccaatcgcaatcagctgcttaatctgaacgtgtca
gcagtgtccagtgtcattggtctcttccaatcccagctgatgaacttccacttggaggct
gatgacacctatcagcccaccctctccgaactcactgaggtgaccatcaagaagctcagc
cagaacaaggaaaacggatactttgcgttcattgaaggtggtctcattgactatggcaac
cactacactaaagctggctatgctttggatgaggctttggaattcgagaaggccattcag
ttggcccgtgacatgacggacatcgaggacactttgattgtggtgaccgctgatcacgga
cacgccgtcagcatagccggctatcctggcagaggaacacccatcctgggaatcaatcaa
catgacaccgacatcaacggagtgaagtactcggttctcaactatgcagctggacccaat
cagtatctggatgagaccggccagcgcattcctctggacgatattcttggctcggacgac
gccatcacccccagctacatttccaaggatcagggcgtgcactccggcgaggacgtgggc
atattcgcgtccggtccgcagagtcatctcttcaccggagtgatgcagcagagcaccatt
ccccacctgatggcatatgcggcgtgcattggaagcggaaagcaggtgtgcgataactga

DBGET integrated database retrieval system