KEGG   Drosophila simulans: Dsimw501_GD25180Help
Entry
Dsimw501_GD25180  CDS       T01065                                 

Gene name
Dsim_GD25180
Definition
(RefSeq) GD25180 gene product from transcript GD25180-RB
  KO
K14298  
mRNA export factor
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsimw501_GD25180 (Dsim_GD25180)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dsimw501_GD25180 (Dsim_GD25180)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dsimw501_GD25180 (Dsim_GD25180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 346 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKC
HRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgccacacaatcgacgaaccggatgaacgacttcgaggtcgcctctccgccg
gacgactccgtctcggcgctggagttcagccccagcacggtgcagaagaacttcctggtg
gccggtagctgggacagcaccgtccgctgctgggaggtggaacaaaacggggccaccgtg
cccaagtcgatgaagaccatgggcggaccagtgctggacgtttgctggtcggacgatggc
agcaaggtgttcgttgcctcctgcgacaagcaggtgaagctctgggacctcgcctccgac
caagtgatgcaagtggcggctcacgacggtcccgtgaaaacgtgccacatggtcaagggc
cccacgtacacctgcctgatgaccggctcctgggacaagaccctaaagttctgggacacc
cgttcgcccaatcccatgatgaccatcaatctacccgagcggtgctactgcgccgatgtg
gagtacccgatggccgtggtgggcacggccaacagaggactcatcatatactcgctgcag
aacagccccaccgagtacaagcggcaggagagtccgctgaagtaccagcaccgtgccatt
tccattttcagggacaagaagaaggagcccacgggctgtgcgctgggcagcattgagggt
cgtgtggccattcagtatgtgaatccggggaatcccaaagataactttaccttcaagtgc
caccgtaccacgggcacctcaggctaccaggatatttatgcagtaaatgacatcgcattc
caccctgtccacggcaccctggtgaccgttggctcagatggcaccttcagtttctgggac
aaagatgcccggaccaagctcaagtccagcgagaccatggatcagtctattaccaaatgc
ggatttaacgccaatggccagatatttgcatacgccgtcggctacgactggtcgaagggc
cacgagtacttcaacccggccaagaagccccaaatctttctgcgctcgtgctacgacgag
ctcaagccgcgcattaactga

DBGET integrated database retrieval system