KEGG   Drosophila simulans: Dsim_GD25180Help
Entry
Dsim_GD25180      CDS       T01065                                 

Definition
GD25180 gene product from transcript GD25180-RA
Orthology
K14298  
mRNA export factor
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsim_GD25180
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dsim_GD25180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 173 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVDAWGTV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgccacacaatcgacgaaccggatgaacgacttcgaggtcgcctctccgccg
gacgactccgtctcggcgctggagttcagccccagcacggtgcagaagaacttcctggtg
gccggtagctgggacagcaccgtccgctgctgggaggtggaacaaaacggggccaccgtg
cccaagtcgatgaagaccatgggcggaccagtgctggacgtttgctggtcggacgatggc
agcaaggtgttcgttgcctcctgcgacaagcaggtgaagctctgggacctcgcctccgac
caagtgatgcaagtggcggctcacgacggtcccgtgaaaacgtgccacatggtcaagggc
cccacgtacacctgcctgatgaccggctcctgggacaagaccctaaagttctgggacacc
cgttcgcccaatcccatgatgaccatcaatctacccgagcggtgctactgcgccgatgtg
gagtacccgatggccgtggtcgatgcgtggggcaccgtgtag

DBGET integrated database retrieval system