KEGG   Drosophila simulans: Dsimw501_GD25217Help
Entry
Dsimw501_GD25217  CDS       T01065                                 

Gene name
Dsim_GD25217
Definition
(RefSeq) GD25217 gene product from transcript GD25217-RC
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dsi  Drosophila simulans
Pathway
dsi00040  Pentose and glucuronate interconversions
dsi00053  Ascorbate and aldarate metabolism
dsi00830  Retinol metabolism
dsi00860  Porphyrin and chlorophyll metabolism
dsi00980  Metabolism of xenobiotics by cytochrome P450
dsi00982  Drug metabolism - cytochrome P450
dsi00983  Drug metabolism - other enzymes
dsi01100  Metabolic pathways
Module
dsi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD25217 (Dsim_GD25217)
   00053 Ascorbate and aldarate metabolism
    Dsimw501_GD25217 (Dsim_GD25217)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsimw501_GD25217 (Dsim_GD25217)
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD25217 (Dsim_GD25217)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsimw501_GD25217 (Dsim_GD25217)
   00982 Drug metabolism - cytochrome P450
    Dsimw501_GD25217 (Dsim_GD25217)
   00983 Drug metabolism - other enzymes
    Dsimw501_GD25217 (Dsim_GD25217)
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsimw501_GD25217 (Dsim_GD25217)
Glycosyltransferases [BR:dsi01003]
 Others
  Hydrophobic molecule
   Dsimw501_GD25217 (Dsim_GD25217)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_trans_4_4 Glyco_transf_4 RSN1_TM Glyco_trans_4_2
Motif
Other DBs
NCBI-GeneID: 6735515
NCBI-ProteinID: XP_016028855
UniProt: A0A0J9RJ62
Position
2R
AA seq 530 aa AA seqDB search
MQFPLLFGLLLAGTLYSQLEIAEGSKILAVYAFPGKSHFMMHTALIRELVESGHQVTMVT
AFTLEKEQLGSNYTEILIEPVYDFWHDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTT
EHALRQPKVRALIHAEQKEGVFDLLLAEQFYQEAFLALAHLYKVPVVTTSTLGYENHMSQ
MMGLITPWSFVPHGFMPFTDRMSFLERVKNSYASFYEDMDRLLNYFPKMDAVAREFFGPV
LAEVPKVKHMEREISVMLLNSHAPLTTARPTVDAMVPVGGMHIYPPKPLPADMQAFLDGA
TEGAIFFSLGSNVQSKDMPVKMLRLFLQVFGSLKQRVLWKFEDESISQLPDNVMVRKWLP
QADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAVLGGYAISLHFQ
SITEEILRHSLDQLIHNATYKENVQRVSDIFRDRPLEPRKSAVYWIEYVIRHRGAPHMRS
AGLDLNWFQFYLLDVIAFVAIIALAGVMVLSLAIRLLMGSNKKHRKAKQN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccattattatttggtctccttttggcgggaacattatattcccagttggaa
atagccgaaggatcgaaaatcctggctgtgtatgcctttccgggaaaatcccattttatg
atgcacactgctttgataagggaacttgtcgaaagtggacatcaggtgaccatggtaaca
gcttttactctggagaaagagcaactgggcagcaactacacggagatcttgatagaaccg
gtctacgatttctggcacgatgttaagctgaattttggagcccagcacctattcgagctg
acccgcatgaccaactatgatttcctcaagatgctggagattatcggcctcaagaccacc
gaacatgccctgcggcagcccaaggttcgggctctcattcatgccgagcagaaggaaggg
gtcttcgatcttctcctggccgagcagttctatcaggaggccttcttggcactggctcat
ctgtacaaagtacccgtggtgaccacgagcactttgggctatgagaaccacatgagtcag
atgatgggtctgattacaccttggtcctttgtaccacacggttttatgcccttcaccgat
cgcatgagtttcctggaaagagtgaagaactcctacgcatccttctacgaagacatggac
aggctgctgaactattttccgaaaatggatgcggtggccagggagttctttggacccgta
ctggccgaggtgcccaaggtcaagcacatggagcgggaaatctcagtgatgctactaaac
agtcacgcaccgctgaccacggcacgtcccacagtggacgccatggtgccagtgggcggt
atgcacatctatccacccaagccgctgccggctgacatgcaagcctttctggatggcgcc
accgagggggccatcttcttcagcctgggcagcaatgtccagagcaaggacatgcccgtg
aaaatgctgcgactgttcctgcaggtattcggttcgctcaagcagcgggtattgtggaaa
ttcgaggacgagagcattagccaattgccagataacgtgatggtcaggaagtggctgcca
caggcggacattctggcccatcggcatgtgaaggtattcattacccatggtggcttgttt
ggcactcaggagggagtgcattacgctgtgcccatgctgggtattcccttctactgtgat
cagcaccttaatatgaacaaagcggttttgggtggctatgccattagtctgcacttccag
tcgattaccgaggaaatactgcggcactccttggaccaacttatccacaatgcgacctac
aaagagaacgttcagagggtatcggatattttccgcgatcgtccgctggagccgcggaaa
agtgccgtctattggatcgaatacgtcatccggcatcgaggtgctccacatatgagatct
gcaggcctggatctcaactggttccaattctacttgctggatgttatagcatttgtggct
atcattgctttagctggagtcatggttctgtcattggccattcgattactgatgggcagt
aataagaaacacaggaaagctaagcaaaattaa

DBGET integrated database retrieval system