KEGG   Drosophila simulans: Dsimw501_GD25218Help
Entry
Dsimw501_GD25218  CDS       T01065                                 

Gene name
Dsim_GD25218
Definition
(RefSeq) GD25218 gene product from transcript GD25218-RA (EC:2.4.1.-)
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dsi  Drosophila simulans
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD25218 (Dsim_GD25218)
   00053 Ascorbate and aldarate metabolism
    Dsimw501_GD25218 (Dsim_GD25218)
   00500 Starch and sucrose metabolism
    Dsimw501_GD25218 (Dsim_GD25218)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsimw501_GD25218 (Dsim_GD25218)
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD25218 (Dsim_GD25218)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsimw501_GD25218 (Dsim_GD25218)
   00982 Drug metabolism - cytochrome P450
    Dsimw501_GD25218 (Dsim_GD25218)
   00983 Drug metabolism - other enzymes
    Dsimw501_GD25218 (Dsim_GD25218)
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsimw501_GD25218 (Dsim_GD25218)
Glycosyltransferases [BR:dsi01003]
 Others
  Hydrophobic molecule
   Dsimw501_GD25218 (Dsim_GD25218)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 532 aa AA seqDB search
MYLKSALHIFLLSLVALQQLELGTGSRILAAFFFPGKSHFMMTNAIIRELVKQGHEVTFI
TPFSLAKEKLGPNYKEIVIPQYDFWPEIKEMTNKNTVLEMTDLPNFAFLRMVNVMGIHST
DFALEQPEIQAVINEKNKIGKYDLLLAEQFFNEGALILGHLYQIPTITVSTFGNANYLSQ
LFGVVSPWSYVPHAYMPYTDRMSLWERIGNVAINAAEDLVREFSYYPGQDAVLKKHFSKL
LDRVPTIKELERNISAILLNSYMPLASSRPMAYNMIPVGGLHIQPPKALPEHLQKFLDGA
THGAIYFSLGSQVRSADLPPEKLKVFLEVFGSLKQRVLWKFEDESLPNLPANVKVQSWLP
QGDILAHPNVKVFIAHGGLFGTQEAVYNSVPILGMPVYCDQHQNINQGKKAEYALGLDYR
KVTVEELRGLLLELIENPKYRNNIKKASRIFRDRPLGAMDTAMYWINYVIEHRGAPHLVA
AGVHLPWYQFYLLDIVGLALAVILLPIVALILICRRSSKPKSTPTKKKTKKN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgaaaagtgctctgcacatttttctcctaagtctggttgctctacagcaacta
gagttgggtacgggttcccgcatcctggcagccttcttttttcctggcaagagccacttc
atgatgaccaatgccatcatacgggagctggtgaagcaaggacatgaggttactttcatt
actccgttttccttggcgaaggaaaaacttggaccaaactataaggaaatagtgattcct
caatacgatttttggccagaaattaaggagatgaccaataaaaacaccgttttggaaatg
actgatttaccaaatttcgccttcctgcgaatggtcaatgtgatgggtatccacagcacg
gatttcgcactggagcaaccggagattcaggccgtaatcaacgagaagaacaagattggc
aaatacgatctgctgctggcggagcagttcttcaacgagggtgccctcatcctgggacac
ttgtaccagatccccaccataactgtttccactttcggtaatgccaactacctcagtcag
ctatttggggtagtgtctccttggtcatatgtaccacatgcctatatgccctacacggat
cgcatgtctttgtgggaacgcatcggcaatgtggccatcaatgccgctgaggatctcgtc
agagagttctcctactaccccggtcaggatgcggtcttaaagaagcacttctccaagctc
ctcgacagagtaccaactatcaaagaacttgaacgtaatatctcagccattctgttgaac
agctacatgccactggcatcttcgagaccaatggcttataatatgatcccagtgggcggt
ttgcacattcaaccaccgaaggcgctgccagagcatcttcaaaaattcctggacggagct
acacatggagccatttacttcagcttgggttcccaggtgagaagtgccgacttgccgcct
gagaagctaaaggtattcctggaagtctttggcagtctgaagcaacgcgttctctggaag
ttcgaggatgaatctctgcccaatctgccggctaacgtgaaggtgcaaagttggttacct
cagggcgacattctggcgcacccgaatgtcaaagttttcattgcccatggaggactcttc
ggcacccaggaggcggtgtacaacagtgttcccatattgggcatgcccgtctactgcgat
cagcaccagaacattaaccagggtaagaaggctgaatatgcgctgggactggattaccgg
aaagtcacggtggaggagttgcgcggtctgctgctggagctgattgagaatccaaagtac
aggaataacattaagaaggcctcccggatattccgcgatcgaccactcggggccatggat
acggccatgtactggatcaactatgtgatcgagcaccgaggtgctcctcatctggtggcc
gctggtgtgcatctaccctggtaccagttctacctactggacattgtgggtctagctctc
gctgtgatcctgctgcccatcgtggctctaatactgatctgccgcaggagctccaagcca
aagagcactccgacgaagaagaagaccaagaagaattag

DBGET integrated database retrieval system