KEGG   Drosophila simulans: Dsim_GD25340Help
Entry
Dsim_GD25340      CDS       T01065                                 

Definition
GD25340 gene product from transcript GD25340-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dsi  Drosophila simulans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dsim_GD25340
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dsim_GD25340
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dsim_GD25340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 193 aa AA seqDB search
MFDKETLFPGLLAAVALVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFGNPVQLDIFAG
HVMLIVNIASRCGLTLSQYNGLRYLLEEYEEQGLRILNFPCNQFGGQMPESDGQEMLDHL
RREGANIGHLFAKIDVKGAQADPLYKLLTRHQHDIEWNFVKFLVDRKGNIHKRYGAELEP
VALTDDIELLLGR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataaagaaactctttttccaggccttttggctgcagtggccttggtagtagta
ctacaaacacgcagcagattgcagcaggatttgcaggatatgcgatggcgtctaacgata
cacgctctcaccgttcgagatacctttgggaatccagtgcaactcgatatattcgccggc
catgtgatgctcatcgtcaacattgcctccagatgcggacttaccttatctcagtacaac
ggtttacgatatttactagaggaatatgaggagcagggcctgagaattttaaactttccc
tgtaaccaatttgggggtcaaatgcccgagtccgatggccaggagatgttggatcacctg
cgcagggagggagccaacataggacaccttttcgccaaaatagatgtgaagggagcccag
gcagatccgctgtacaagctcctaacgcgccaccagcatgatatcgagtggaattttgtc
aagtttctggtggatcgaaagggaaacatacacaagagatatggcgccgaactggaacca
gttgccctgaccgatgacatagagctgctgctcggcagatga

DBGET integrated database retrieval system