KEGG   Drosophila simulans: Dsim_GD25494Help
Entry
Dsim_GD25494      CDS       T01065                                 

Gene name
Dsim_Amy-p
Definition
Amylase proximal
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dsi  Drosophila simulans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dsim_GD25494 (Dsim_Amy-p)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dsim_GD25494 (Dsim_Amy-p)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 234 aa AA seqDB search
MFLAKSIVCLALLAVANAQFDTNYASGRSGMVHLFEWKWDDIAAECENFLGPNGFAGVQV
SPVNENAVKDSRPWWERYQPISYKLETRSGNEQQFASMVKRCNAVGVRTYVDVVFNHMAA
DGGTYGTGGSTASPSSKSYPGVPYSSLDFNPTCAINNYNDANQVRNCELVGLRDLNQGNS
YVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPADLAVIYGRLQNLNTDHGFASGS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtttctggctaagagcatagtgtgcctcgccctgctggcggtggccaacgcccaattc
gacaccaactacgcctccggtcgtagtggaatggtccacctcttcgagtggaagtgggac
gacatcgctgccgagtgcgagaacttcctgggacccaatggcttcgccggtgtccaggtc
tcccctgtgaacgagaacgccgtcaaggacagccgcccctggtgggaacgttaccagccc
atctcctacaagctggagacccgctccggaaacgagcagcagttcgccagcatggtcaag
cgctgcaacgccgtcggagtgcgcacctacgtggacgtggtcttcaaccacatggccgcc
gacggaggcacctacggcactggcggcagcactgccagccccagcagcaagagctatccc
ggagtgccctactcctcgctggacttcaacccgacctgcgccatcaacaactacaacgac
gccaaccaggtgcgcaactgcgagctggtgggtctgcgtgacctcaaccagggcaactcc
tacgtgcaggacaaggtggtcgagttcctggaccatctgattgacctcggcgtggccgga
ttccgcgtggacgccgccaagcacatgtggcccgccgacctggccgtcatctatggccgc
ctccagaacctgaacaccgaccacggcttcgcctcgggatcctag

DBGET integrated database retrieval system