KEGG   Drosophila simulans: Dsimw501_GD25544Help
Entry
Dsimw501_GD25544  CDS       T01065                                 

Gene name
Dsim_GD25544
Definition
(RefSeq) GD25544 gene product from transcript GD25544-RC (EC:3.2.1.-)
  KO
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
dsi  Drosophila simulans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dsimw501_GD25544 (Dsim_GD25544)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dsimw501_GD25544 (Dsim_GD25544)
   00600 Sphingolipid metabolism
    Dsimw501_GD25544 (Dsim_GD25544)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Dsimw501_GD25544 (Dsim_GD25544)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsimw501_GD25544 (Dsim_GD25544)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dsimw501_GD25544 (Dsim_GD25544)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 417 aa AA seqDB search
MYGTWGVFLGGILLLQVLQLSMGLDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKL
FRRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHYQ
GLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFADWDVDYVKLDGCYANISDMATGYPEFG
RLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQHCNLWRNWDDIEDSLESLMQIIDYFA
KNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWAIMAAPLIMSNDLAAVRPEI
KAILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKSGHHSYAVAFVSRRDDGA
PYRIPFTVKEFGLTNPNGYNVQDLYDVSNKLGIFQSESQFITRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaacgtggggcgtctttctgggcgggattctcctgctgcaggttctgcaatta
tccatgggcctcgataatggcctggcactaaagccacctatgggctggatgtcctgggaa
cgcttccgttgcattaccgactgtaaactgtatccggatgagtgcatcagtgaaaaacta
ttccgaagacatgcggatctccttgtttctgaaggatatgcggatgctggctacgagtac
gtcatcatagatgactgctggctggagaagaatcgcgacaacgatacccagaagctggtt
ccggacagaaagcgctttcccaacggcctaaatgctttatccgatcatatccactaccag
ggtctgaagtttggcttgtaccaggattacggcaccaacacctgcgctggctatcccgga
gtgatcaagcacatgaagctggacgcacagacctttgcggattgggacgtggactacgtg
aagctggacggctgctatgccaatatcagcgacatggctacgggatatccggagttcgga
cgcctgctcaatgaaactggtcgtccgatggtgtactcctgcagttggcccgcttatcag
gaggatgcaggagaaatgcccgactatgagtcactcaagcagcactgtaatctgtggcgc
aactgggacgacatcgaagactcgctcgagtccctcatgcagatcatagactactttgcc
aagaatcaggacaggattcagccgcatggcggaccaggacactggaacgatcccgatatg
ctgctgctgggaaactacggcttgagttacgatcaaagcaagctgcagatggccatttgg
gccattatggcggcacctctaattatgtccaatgatctggctgcagtgcgtcccgaaatc
aaggctatactgcagaatcgtgcggttattgctgtggaccaggatgagctgggcatccag
ggccgtcgtgttttgtcccgcaaccaaatcgaagtctggaaacgtcccattacgccagta
accaagagtggacatcactcctatgccgtcgccttcgtcagtcgccgagatgatggcgct
ccctacaggatccccttcacggtcaaggagttcggactgacgaatccaaatggttataat
gtgcaggatctatacgatgtcagcaacaagttgggcatcttccagtcggagagtcagttc
atcacacgcgtcaatcccaatggcgtaactttctacaagtttacagcgttgtaa

DBGET integrated database retrieval system