KEGG   Drosophila simulans: Dsimw501_GD25558Help
Entry
Dsimw501_GD25558  CDS       T01065                                 

Gene name
Dsim_GD25558
Definition
(RefSeq) GD25558 gene product from transcript GD25558-RB (EC:3.2.1.17)
  KO
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dsimw501_GD25558 (Dsim_GD25558)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsimw501_GD25558 (Dsim_GD25558)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 148 aa AA seqDB search
MWPIWLLVLLSLSLATGRQVGRCSLARQLYRYGMAYNELPDWLCLVEGESSFNTKAINPS
NVDGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFS
AWVAWNNRCQGVKPNVNHCFRRRHRNSG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccatttggctgctggtgctcttatcgctatcactggccactggccgccaggtg
ggcagatgcagtttggctcggcagctctatcggtatggaatggcctacaacgagctgccc
gactggctgtgcctcgtggagggcgagagctccttcaacacgaaagccattaatccctca
aacgtcgatggatccgtggactggggtctcttccagatcaacgatcgctactggtgcaag
ccggcggatgggcgtccctccaacgatctctgtcgcttgccctgccgcctgctgttaagc
gacgatatccggtattccattgcctgtgcgaagtacatcaggaaacagcaaggattctcc
gcctgggtggcttggaacaatcgatgtcagggtgttaagcccaatgtgaatcactgcttc
cggcggcgccacagaaattcgggttga

DBGET integrated database retrieval system