KEGG   Drosophila simulans: Dsim_GD25630Help
Entry
Dsim_GD25630      CDS       T01065                                 

Definition
GD25630 gene product from transcript GD25630-RA
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsim_GD25630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsim_GD25630
   00051 Fructose and mannose metabolism
    Dsim_GD25630
   00052 Galactose metabolism
    Dsim_GD25630
   00500 Starch and sucrose metabolism
    Dsim_GD25630
   00520 Amino sugar and nucleotide sugar metabolism
    Dsim_GD25630
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    Dsim_GD25630
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dsim_GD25630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 454 aa AA seqDB search
MLDAEVRELMQPFVLSDYQVQEVYSRFCLEVARGLKRSTHPQANVKCFPTYVQDLPTGDE
MGKYLALDLGGTNFRVLLVSLKGHHDATVDSQIYAVPKDLMVGPGVDLFDHIAGCLAKFV
EKHDMKTAYLPLGFTFSFPCVQQGLKEGILVRWTKGFDCAGVEGEDVGRMLHEAIQRRGD
ADIAVVAILNDTTGTLMSCAHRNADCRVGVIVGTGCNACYVEDVENVDLLRADFKKTKRS
VIVNAEWGAFGEGGQLDFVRTEYDREIDEKSLNRSEQLFEKMTAGMYLGNLVRLVLLRAL
ERKLIFKQSSRRPEFASVLQRNEEVFETRYISEIEDDSFPEFASTRKIVKNLFGLEKASV
EDCQTLRYICECVAKRAATLVAIGVSGLVNRTSNRRVIVGMDGSVYRYHPKFDAYMRQTL
QKLVKADKEWDIMLSEDGSGRGAALVAAVASKTK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgcggaggtgcgagaacttatgcaaccctttgtgctgagtgattaccaggtg
caggaagtgtacagtcgcttttgcttggaagtggcccgtggactcaagcggtccacgcat
ccacaggccaatgtcaagtgttttcccacgtacgtgcaggatctgcccacgggcgacgag
atgggcaagtatctggccctggatctcggaggaaccaacttccgggtgctgctcgtctcg
ctgaaaggtcaccatgacgccacggtggattctcagatctatgccgtgccaaaggacctg
atggtggggcccggtgtggacctattcgatcacattgcgggctgcctggccaaatttgtg
gagaaacacgacatgaagaccgcatatctgccactgggcttcactttttcctttccttgc
gtgcagcaaggccttaaggagggcatcctggtacgctggactaagggattcgattgtgct
ggtgttgagggcgaggatgtgggccgcatgctgcacgaggccattcagcggcgcggagat
gccgacattgccgtggtggctatactcaacgataccactggcaccttgatgtcctgcgcc
catcgtaacgcggattgccgggtgggtgtcattgtgggcactggctgcaatgcctgctac
gttgaggatgttgagaatgtggacctcttgcgcgcagactttaaaaaaacgaagcggagt
gttattgtaaatgctgagtggggcgcttttggtgagggtggtcagttggactttgtgcgc
accgaatacgatcgcgaaatcgacgaaaagtctctcaaccgatcggagcagctgttcgaa
aagatgacggcgggcatgtacttgggcaacctggtgcgccttgtcctacttcgtgccctc
gagcgcaagctgatctttaaacagagcagtcgacgtccagaattcgccagcgtgctgcag
agaaacgaagaggttttcgagacgcgctacatatcggaaatcgaggacgactcctttccg
gagtttgccagcacaaggaagattgtgaaaaatctgtttggattggagaaggcctccgtg
gaggactgccagactctgagatacatctgcgagtgcgtagctaagcgagcggccacatta
gtagccatcggagtgagtggactggtgaacaggacctccaaccgccgcgtgatagtcggc
atggatggctccgtctacagataccatccaaagttcgatgcctacatgaggcagacactc
caaaagctggtgaaagcagacaaggagtgggacatcatgctatctgaggacggatccgga
cgtggagctgcgctggtggccgcggtggccagtaaaacaaagtag

DBGET integrated database retrieval system