KEGG   Drosophila simulans: Dsim_GD25630Help
Entry
Dsim_GD25630      CDS       T01065                                 

Definition
GD25630 gene product from transcript GD25630-RA
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:dsi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dsi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dsi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dsi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dsi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dsi00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 454 aa AA seqDB search
MLDAEVRELMQPFVLSDYQVQEVYSRFCLEVARGLKRSTHPQANVKCFPTYVQDLPTGDE
MGKYLALDLGGTNFRVLLVSLKGHHDATVDSQIYAVPKDLMVGPGVDLFDHIAGCLAKFV
EKHDMKTAYLPLGFTFSFPCVQQGLKEGILVRWTKGFDCAGVEGEDVGRMLHEAIQRRGD
ADIAVVAILNDTTGTLMSCAHRNADCRVGVIVGTGCNACYVEDVENVDLLRADFKKTKRS
VIVNAEWGAFGEGGQLDFVRTEYDREIDEKSLNRSEQLFEKMTAGMYLGNLVRLVLLRAL
ERKLIFKQSSRRPEFASVLQRNEEVFETRYISEIEDDSFPEFASTRKIVKNLFGLEKASV
EDCQTLRYICECVAKRAATLVAIGVSGLVNRTSNRRVIVGMDGSVYRYHPKFDAYMRQTL
QKLVKADKEWDIMLSEDGSGRGAALVAAVASKTK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgcggaggtgcgagaacttatgcaaccctttgtgctgagtgattaccaggtg
caggaagtgtacagtcgcttttgcttggaagtggcccgtggactcaagcggtccacgcat
ccacaggccaatgtcaagtgttttcccacgtacgtgcaggatctgcccacgggcgacgag
atgggcaagtatctggccctggatctcggaggaaccaacttccgggtgctgctcgtctcg
ctgaaaggtcaccatgacgccacggtggattctcagatctatgccgtgccaaaggacctg
atggtggggcccggtgtggacctattcgatcacattgcgggctgcctggccaaatttgtg
gagaaacacgacatgaagaccgcatatctgccactgggcttcactttttcctttccttgc
gtgcagcaaggccttaaggagggcatcctggtacgctggactaagggattcgattgtgct
ggtgttgagggcgaggatgtgggccgcatgctgcacgaggccattcagcggcgcggagat
gccgacattgccgtggtggctatactcaacgataccactggcaccttgatgtcctgcgcc
catcgtaacgcggattgccgggtgggtgtcattgtgggcactggctgcaatgcctgctac
gttgaggatgttgagaatgtggacctcttgcgcgcagactttaaaaaaacgaagcggagt
gttattgtaaatgctgagtggggcgcttttggtgagggtggtcagttggactttgtgcgc
accgaatacgatcgcgaaatcgacgaaaagtctctcaaccgatcggagcagctgttcgaa
aagatgacggcgggcatgtacttgggcaacctggtgcgccttgtcctacttcgtgccctc
gagcgcaagctgatctttaaacagagcagtcgacgtccagaattcgccagcgtgctgcag
agaaacgaagaggttttcgagacgcgctacatatcggaaatcgaggacgactcctttccg
gagtttgccagcacaaggaagattgtgaaaaatctgtttggattggagaaggcctccgtg
gaggactgccagactctgagatacatctgcgagtgcgtagctaagcgagcggccacatta
gtagccatcggagtgagtggactggtgaacaggacctccaaccgccgcgtgatagtcggc
atggatggctccgtctacagataccatccaaagttcgatgcctacatgaggcagacactc
caaaagctggtgaaagcagacaaggagtgggacatcatgctatctgaggacggatccgga
cgtggagctgcgctggtggccgcggtggccagtaaaacaaagtag

DBGET integrated database retrieval system