KEGG   Drosophila simulans: Dsim_GD25738Help
Entry
Dsim_GD25738      CDS       T01065                                 

Definition
GD25738 gene product from transcript GD25738-RA
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dsi  Drosophila simulans
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsim_GD25738
   01212 Fatty acid metabolism
    Dsim_GD25738
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dsim_GD25738
   00650 Butanoate metabolism
    Dsim_GD25738
  Lipid metabolism
   00062 Fatty acid elongation
    Dsim_GD25738
   00071 Fatty acid degradation
    Dsim_GD25738
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dsim_GD25738
   00310 Lysine degradation
    Dsim_GD25738
   00380 Tryptophan metabolism
    Dsim_GD25738
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dsim_GD25738
Enzymes [BR:dsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dsim_GD25738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 294 aa AA seqDB search
MANIAKIFASRAQGVLQAAARQPQVATRFSSSSTNNWEYIKTEVAGEGKNVAVITLNRPK
ALNALCNGLMKELSTALQQFGKDKTISAIVLTGSEKAFAAGADIKEMVGNTYSQCIQGNF
LNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGT
QRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLI
VQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRPAKFTNE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggccaacattgctaagatcttcgccagccgcgcccagggcgtcctgcaggcagccgcc
cgccagccacaggtggccacccgtttcagcagctcctccaccaacaactgggagtacatc
aagaccgaagtggccggcgagggcaagaacgtggccgttatcaccctgaaccgccccaag
gctttgaatgccctctgcaatggcctgatgaaggagctgtccaccgcgttgcagcaattc
ggcaaggataagaccatctccgccatcgttttgacgggcagtgagaaggccttcgccgct
ggcgctgatatcaaggagatggtgggcaacacctactcgcagtgcatccagggcaacttc
ctgaacgactggacggaggtggcccgcacccagaagcccatcattgctgccgtgaatggt
tacgccttgggcggtggctgtgagctggccatgatgtgcgacatcatctatgccggtgac
aaggccaagtttggtcagcctgagattgccctgggcaccattcccggagccggtggcacc
cagcgtctgacccgcgtcgttggcaagtccaaggccatggagatgtgcctcaccggcaac
atgatcggcgcccaggaggccgagaagctgggtctggccagcaaggtggtgcccgccgac
cagttgctgggcgaggccgtcaagctgggcgagaagatcggcacccactccaatctgatt
gtgcagctgtgcaaggaggccgttaacacggcttacgagaccactctccaggagggtctg
aagttcgagcgtcgcaccttccatgccacgttctccacggccgatcgcaaggagggcatg
accgccttcgccgagaagcgccctgccaagtttaccaacgagtaa

DBGET integrated database retrieval system