KEGG   Drosophila simulans: Dsim_GD25822Help
Entry
Dsim_GD25822      CDS       T01065                                 

Definition
GD25822 gene product from transcript GD25822-RA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dsi  Drosophila simulans
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dsim_GD25822
   00330 Arginine and proline metabolism
    Dsim_GD25822
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dsim_GD25822
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Dsim_GD25822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 716 aa AA seqDB search
MLKGVPTLAGRNLRLLTTQAQVLVHQRGKASAVEPVEDFDQETDLLKRAKFGHTGKQLQQ
KIINEKKLRAPPLMNLVFANRKLSFYDTSSTPKTKEDNAKLSQRRHYSMRPHREQEQRNA
EDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAE
TQHLNRETFKAVVAPNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIP
QLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQ
EPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSG
GEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAM
SVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGG
MMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRKHRY
ETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECVKFLLE
QCHVPHNPKDRWGNLPVDEAENFGHSHVVEFLRSWAEKADQSSEECKPEAVTSKTQADEE
ICSTSDLETSPTTSPIPTPVESGSRAGSGRSSPVPSDAGSTASAGSSIDDKTKPGL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaggtgttcccacgctagccggtcgaaaccttcgtctcctgacgacccaggca
caggtgctggtccatcaacgcggcaaggcgtccgccgtcgagcccgtcgaggatttcgac
caggagacggatctcttgaagcgcgccaagttcggacacacaggcaaacagctgcagcag
aaaataatcaatgagaaaaaactgcgcgctccaccgcttatgaacttggtgtttgccaat
cggaagttgtccttctacgataccagttccacgcccaagaccaaagaggataatgccaag
ctcagtcagagacgccactattcgatgcggccccatcgcgagcaggagcagcgaaatgcg
gaggatgtgctattcgacatgttcgccagcgaggagacgggcctcatctcgatgggcaag
ttcctggccgggctaaagaccaccggaattcgccggaacgatccgcgagtgcgagaactg
atggacaacttgaagaaagtgcacaagctgaataactacgagacgggttcttcggcggaa
actcagcatctcaatcgggagaccttcaaggctgtggtggcccccaatattgtgctgatt
gccaaggccttccggcagcagttcgtgatccccgactttacgagtttcgtcaaggacatc
gaggacatttacaatcgctgcaagaccaacactttgggcaagttggccgactacattccc
cagctggctcgctataatcccgattcctggggcctgagcatctgcaccattgatggtcag
cgcttctccatcggcgatgtggatgtgcccttcacactccagagttgcagcaagccactg
acctacgccattgccctggagaaactgggtcccaaggtcgtgcactcgtatgtgggccag
gagccgagtggcaggaacttcaacgaacttgtcctggatcagaacaaaaagccacacaat
ccaatgatcaacgcaggtgccattctgacctgctccctgatgaacgccctggtcaagccg
gacatgacctccgctgagatcttcgactacaccatgtcctggttcaagcggctgtccggc
ggggagtatatcggctttaacaacgccgtattcctgtccgaacgcgaggctgccgatagg
aactacgccctgggcttctacatgcgggagaacaagtgcttccccaagcgcaccaatctt
aaggaggtgatggacttctacttccagtgctgctccatggagaccaattgcgaggcaatg
tccgtgatcgcagccagtttggccaatggtggcatctgccccaccaccgaggagaaggtg
ttccggccggaggtaatccgggatgtgctctcgatcatgcactcatgcggcacatacgac
tactccggacagttcgccttcaaggtgggtctgccagccaagtctggagtgagtggcggc
atgatgctggtcatccccaacgtaatgggcatctttgcctggtccccgcccttggatcac
ttgggtaatacagtgagaggactacagttttgtgaggagctggtctccatgttcaatttc
catcgctacgacaacctgaagcatctgtccaacaagaaggatccgcggaagcaccgctac
gagaccaagggtctgtccatcgtgaatctgctcttttcagctgccagcggcgatgttacg
gccttgcggcgtcatcgtctctccggaatggatatcaccctggccgactacgatggtcgc
actgccctccatttggctgcctccgagggacacttggagtgcgtcaagttcctgctggaa
cagtgtcatgtaccccacaaccccaaggatcgctggggaaatctgcccgtggatgaggca
gagaacttcggccacagccacgtggtggagttcctccgctcctgggcggagaaggccgac
cagtccagcgaggagtgcaagccagaggcggtgaccagcaagacacaagcggatgaggaa
atctgcagcacaagcgacctggagaccagtccgacaaccagtcccattcccactcccgtg
gaatccggatccagggcaggatcaggacgttccagcccggtgccatcggatgcgggcagc
acggcgagcgccggaagcagcatcgatgacaaaaccaagccgggactataa

  All links  
No link information was found.   
DBGET integrated database retrieval system