KEGG   Drosophila simulans: Dsimw501_GD25835Help
Entry
Dsimw501_GD25835  CDS       T01065                                 

Gene name
Dsim_GD25835
Definition
(RefSeq) GD25835 gene product from transcript GD25835-RD
  KO
K20730  
beta-hexosaminidase Fdl [EC:3.2.1.52]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsimw501_GD25835 (Dsim_GD25835)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dsimw501_GD25835 (Dsim_GD25835)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2R
AA seq 660 aa AA seqDB search
MSLAVSLRRALLVLLTGAIFILTVLYWNQGVTKAQAYNEALERPHSHHDASGFPIPVEKS
WTYKCENDRCMRVGHHGKSTKRVSFISCSMTCGDVNIWPHPTQKFLLSSQTHSFSVEDVQ
LHVDTAHREVRKQLQQAFDWFLKDLRQIQRLDYVGSSSEPTVSESSSKSRHHADLEPAAT
LFGATFGVKKVGDLTSVQVKISVLKSGDLNFSLDNDETYQLSTQTEGHRLQVEITANSYF
GARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIV
GMGLAKMNRFHWHLTDAQSFPYISRYYPELAEHGAYSESETYSEQDVREVAEFAKIYGVQ
VIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQPWSFYCGEPPCGQLNPKNNYTYLILQR
LYEELLQHSGPTDFFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAMVRLKLANNGVAP
KHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGS
WRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWP
RTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEALFPKYCAQNPGECI
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccttggctgtatcgctgcgccgagctctgttggtgctgctcaccggcgccatattc
atcctgacggtgctctactggaaccaaggagtcaccaaggcccaggcttacaatgaggcg
ctggaacgcccccacagccatcacgatgccagtggctttcccatacccgtcgagaagtcc
tggacgtacaagtgcgagaatgaccgatgcatgcgggtgggccaccatggtaaatccacc
aagagggtctcgttcatcagctgttcgatgacgtgtggtgacgttaacatttggccgcac
cccacccagaaattcctgctcagctcccagacgcacagcttctctgtagaggatgtgcag
ctgcacgtggacacggcgcatcgtgaagtacgcaagcagctccaacaggcttttgactgg
ttccttaaggatctcaggcaaatccagcggctggactacgtgggtagttcatcagagccg
accgtaagcgagtcctcatcgaaatcacgccaccacgcggatttggaaccagctgccacg
ctctttggagctacctttggtgtaaagaaggttggggatctaactagcgtacaggtcaag
atcagcgtgctcaagtccggagatcttaactttagcttagacaatgacgagacctatcag
cttagcactcaaaccgaaggacaccgcctgcaggtggagatcaccgcaaactcttacttc
ggagcccggcatggactgtctacgctgcagcaactgatatggtttgacgacgaagatcat
ctgttgcatacgtatgccaatagcaaggtgaaggatgcgcccaagttccggtatcgaggc
ctcatgctggacacctctcgccacttcttctctgtggagtcaatcaagcgaacgattgtg
ggcatgggcctggccaagatgaaccgcttccactggcacctcacagatgcccagagtttc
ccctacatttcgcgctactatccagagttggccgagcacggagcctactcggagagcgag
acatactcggagcaagatgttcgcgaggtggccgagttcgccaagatctatggcgttcag
gtcatacccgagatcgatgcgcctgcccatgcgggcaatggctgggattggggacccaag
cgcggaatgggcgagctggccatgtgcatcaaccagcagccatggagcttctactgtggc
gaaccgccgtgcggccagctgaatccgaagaataactatacctacctcattctgcagcgc
ctctacgaggagttgttgcaacactcgggccccacagacttcttccacctgggcggtgac
gaggtgaatcttgattgctgggcgcaatacttcaatgatacagatctccgcggattgtgg
tgcgatttcatgctccaggctatggtcagactaaaactggccaacaatggagtagcaccc
aagcacgtggcagtctggtcgagcgccctgaccaacaccaagtgtcttccaaacagtcaa
ttcaccgttcaggtatggggcggcagcacctggcaggagaactacgatttgctggacaac
ggctacaacgtaatcttctcgcatgtggacgcctggtatctggactgcggcttcggtagc
tggcgggccactggggatgctgcctgtgctccgtaccgcacatggcagaacgtctacaag
cacaggccgtgggagcgcatgcgattggataagaagcgaaagaagcaggtgctgggcggc
gaagtgtgcatgtggaccgagcaggtggacgaaaatcagttggacaaccggctgtggccc
cgtacagcagctctggcggagcgcttgtggaccgatcctagcgatgatcacgatatggac
atagtgccgccagatgttttccgcagaatctcactgtttcgaaatcgactcgtcgaactg
ggcatccgggctgaagcgctgtttccaaaatactgtgcccagaatcccggcgaatgcatt
tga

DBGET integrated database retrieval system