KEGG   Drosophila simulans: Dsim_GD25835Help
Entry
Dsim_GD25835      CDS       T01065                                 

Definition
GD25835 gene product from transcript GD25835-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dsim_GD25835
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dsim_GD25835
   00603 Glycosphingolipid biosynthesis - globo series
    Dsim_GD25835
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dsim_GD25835
   00511 Other glycan degradation
    Dsim_GD25835
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsim_GD25835
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dsim_GD25835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 673 aa AA seqDB search
MRYVYESLRYLYKMSLAVSLRRALLVLLTGAIFILTVLYWNQGVTKAQAYNEALERPHSH
HDASGFPIPVEKSWTYKCENDRCMRVGHHGKSTKRVSFISCSMTCGDVNIWPHPTQKFLL
SSQTHSFSVEDVQLHVDTAHREVRKQLQQAFDWFLKDLRQIQRLDYVGSSSEPTVSESSS
KSRHHADLEPAATLFGATFGVKKVGDLTSVQVKISVLKSGDLNFSLDNDETYQLSTQTEG
HRLQVEITANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSR
HFFSVESIKRTIVGMGLAKMNRFHWHLTDAQSFPYISRYYPELAEHGAYSESETYSEQDV
REVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQPWSFYCGEPPCGQL
NPKNNYTYLILQRLYEELLQHSGPTDFFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQA
MVRLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFS
HVDAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTE
QVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEAL
FPKYCAQNPGECI
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgtatacgaaagcctacgctatctctataagatgtccttggctgtatcgctg
cgccgagctctgttggtgctgctcaccggcgccatattcatcctgacggtgctctactgg
aaccaaggagtcaccaaggcccaggcttacaatgaggcgctggaacgcccccacagccat
cacgatgccagtggctttcccatacccgtcgagaagtcctggacgtacaagtgcgagaat
gaccgatgcatgcgggtgggccaccatggtaaatccaccaagagggtctcgttcatcagc
tgttcgatgacgtgtggtgacgttaacatttggccgcaccccacccagaaattcctgctc
agctcccagacgcacagcttctctgtagaggatgtgcagctgcacgtggacacggcgcat
cgtgaagtacgcaagcagctccaacaggcttttgactggttccttaaggatctcaggcaa
atccagcggctggactacgtgggtagttcatcagagccgaccgtaagcgagtcctcatcg
aaatcacgccaccacgcggatttggaaccagctgccacgctctttggagctacctttggt
gtaaagaaggttggggatctaactagcgtacaggtcaagatcagcgtgctcaagtccgga
gatcttaactttagcttagacaatgacgagacctatcagcttagcactcaaaccgaagga
caccgcctgcaggtggagatcaccgcaaactcttacttcggagcccggcatggactgtct
acgctgcagcaactgatatggtttgacgacgaagatcatctgttgcatacgtatgccaat
agcaaggtgaaggatgcgcccaagttccggtatcgaggcctcatgctggacacctctcgc
cacttcttctctgtggagtcaatcaagcgaacgattgtgggcatgggcctggccaagatg
aaccgcttccactggcacctcacagatgcccagagtttcccctacatttcgcgctactat
ccagagttggccgagcacggagcctactcggagagcgagacatactcggagcaagatgtt
cgcgaggtggccgagttcgccaagatctatggcgttcaggtcatacccgagatcgatgcg
cctgcccatgcgggcaatggctgggattggggacccaagcgcggaatgggcgagctggcc
atgtgcatcaaccagcagccatggagcttctactgtggcgaaccgccgtgcggccagctg
aatccgaagaataactatacctacctcattctgcagcgcctctacgaggagttgttgcaa
cactcgggccccacagacttcttccacctgggcggtgacgaggtgaatcttgattgctgg
gcgcaatacttcaatgatacagatctccgcggattgtggtgcgatttcatgctccaggct
atggtcagactaaaactggccaacaatggagtagcacccaagcacgtggcagtctggtcg
agcgccctgaccaacaccaagtgtcttccaaacagtcaattcaccgttcaggtatggggc
ggcagcacctggcaggagaactacgatttgctggacaacggctacaacgtaatcttctcg
catgtggacgcctggtatctggactgcggcttcggtagctggcgggccactggggatgct
gcctgtgctccgtaccgcacatggcagaacgtctacaagcacaggccgtgggagcgcatg
cgattggataagaagcgaaagaagcaggtgctgggcggcgaagtgtgcatgtggaccgag
caggtggacgaaaatcagttggacaaccggctgtggccccgtacagcagctctggcggag
cgcttgtggaccgatcctagcgatgatcacgatatggacatagtgccgccagatgttttc
cgcagaatctcactgtttcgaaatcgactcgtcgaactgggcatccgggctgaagcgctg
tttccaaaatactgtgcccagaatcccggcgaatgcatttga

DBGET integrated database retrieval system