KEGG   Drosophila simulans: Dsimw501_GD25839Help
Entry
Dsimw501_GD25839  CDS       T01065                                 

Gene name
Dsim_GD25839
Definition
(RefSeq) GD25839 gene product from transcript GD25839-RA (EC:3.4.19.12)
  KO
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsimw501_GD25839 (Dsim_GD25839)
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsimw501_GD25839 (Dsim_GD25839)
Ubiquitin system [BR:dsi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dsimw501_GD25839 (Dsim_GD25839)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 851 aa AA seqDB search
MAVKQNNSEAGDASDNAGGAGNGIPPNAKPMSANGLANAEENVVPKGMDTGSPSGESLNS
NRSGKRDIKALLAYLQSIDMPEQGHNVMAICERVIVDLARLQIPRGASCPRLKEDVCQVG
AFLATRNEKFHQMFYLRVVYELITKSPFEPPPSCAVAIVFQLFDSTQILEAVHSLLEQNV
QDSSIKKTVNLLCDWITYCTFCSTLNLWVLALLKGLRDQGKMALLDEIAMDNIEKLFHVM
IFPALRQKAAPVVFHMLSTINQTPEVFHKILPRIPRVLQYVKNQSATMDEIGLETKKCLQ
QLVDLTSALMLRFYDQDELYVATKKALQTYEPSPNCMALAKAMHENAQPWGRRNARVGLV
NLGNTCYMNSVLQALAMTSDFSRQILLIEGNSVLLMKVQQQIALMHHSLRYELTPSKVLN
ATRPPSFTPGLQQDSSEFLGHLLDLLHEHEIGNSLVTGHSGGPSKTGKEMDDVPALLSED
ILSSGVIPYNSKDHELSSGSNSDNCNHKPTPTLPATPTKATNGLQQQDQQVDQARPPSTI
DKTFAGKLSTTYRCLSCGWESRNEDSFRELQLSFPDDQEDCGATNYSVQDLIEYYCSPEK
LDGENQYFCPQCKRLCDAERHIGVTQAPKNLILTLKQFKYDQKYHFRTKLMHKVFHDESV
TVKMSAKDSLQEMSTVHYDLYAGVVHAGYSMDSGHYFTFAADQAKNWYKFNDNVVTHSKP
EEMHNLTSPNTPYILFYKMCGHSNESNSATASCSSSMVSRSNDQVVSVPLAPPLKLEELP
RRLRDYVRKDNHVYNEELKMQRFKRGNSGHGNAFVSRHNFDGDGDEDDKGPPPPGGCGGN
GLGMNINRFVF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggccgttaagcagaataacagcgaggcgggtgacgcctcggataatgccggaggagct
ggcaacggcattccgcccaacgccaaacccatgtccgcgaacggactggcgaacgccgaa
gagaacgtagtgccaaagggcatggacacgggatcgccatctggcgagagcctgaactcc
aaccgatcgggcaagcgggacattaaggccctgctggcatacctccaaagcatcgatatg
ccggagcaaggccacaatgtgatggccatctgcgagagggttatcgtggacttggcccgt
ctgcaaattccacgaggcgcatcctgtccacgcctaaaggaagacgtctgccaggtcggc
gcctttctggccacgcgcaacgagaagttccaccaaatgttctacctgcgtgtcgtctac
gagctgatcaccaagtcgccgttcgaaccaccaccctcgtgtgccgtggccattgtgttc
cagctgttcgactccacgcagatcctggaggctgtacactcgctactggaacagaatgtg
caggactcgagcattaagaagacggtgaacctgctctgtgattggatcacgtactgcacc
ttttgcagcactctcaatctctgggtgctggcgcttctcaaggggctaagggatcagggc
aaaatggcgctgctcgacgagattgcaatggacaacatcgagaagctgttccacgtgatg
atctttccggcgctgaggcaaaaggccgcaccggttgtgtttcacatgctgtcaacgatt
aatcagacccccgaggtttttcacaagatcttgccaaggatcccacgagtcctgcagtat
gtgaagaatcagtcggccaccatggacgagattggcctggaaaccaagaaatgtctgcag
cagctggtcgacctaaccagcgccctaatgctacgtttctacgatcaggatgagctctat
gttgcaaccaagaaggccctgcagacatatgagccctctcccaattgcatggctctggcg
aaggcaatgcatgagaatgcccagccgtggggtcggcggaatgcaagggttggactcgtt
aacctggggaacacctgctacatgaatagcgtactacaggcgctagccatgaccagcgat
tttagcaggcaaatcctgcttatcgaaggcaattcagtgctgctcatgaaagtgcagcag
cagatcgccctgatgcaccactcgctgcgctacgaactgacgccttcgaaagtgctgaac
gccacccggccgccaagtttcacgcccggcctacaacaggacagctctgagttcctagga
catctgctcgacttgctgcacgagcacgagatcggcaactccttagtcactggtcacagt
ggtggtccttcaaagaccggcaaggaaatggacgatgtgcccgcactgctgagcgaggat
atattgtcgagcggggtaattccgtacaacagcaaggatcacgagctcagcagtggaagc
aacagtgacaattgtaatcacaagcccacaccgacactacccgcgactcccaccaaagcc
accaacggcttacagcagcaggaccagcaggtcgatcaggcgaggccaccatctaccatt
gacaagacgttcgctggcaagctttccaccacctaccgatgtttgagctgcggctgggag
agccgtaacgaggacagcttccgcgaactccagctgtcatttcccgacgatcaggaagac
tgtggagccaccaactactctgtgcaggatctgatcgagtactactgctcgcccgagaag
ctggacggtgagaatcaatatttctgtccacaatgcaagaggctgtgcgatgcggagcgc
cacatcggggtcacccaggcaccgaagaaccttattctcacgcttaagcagttcaagtac
gatcagaagtaccacttccgcaccaagctcatgcataaggtgttccacgatgagagcgtc
acagtaaaaatgtcggcaaaggactcgctgcaggagatgtcaactgtgcactatgatctg
tatgcgggtgttgtgcacgccgggtacagcatggattccggccattactttacgttcgcg
gcggatcaagccaagaattggtacaagttcaacgataacgtggttacccactccaaaccg
gaggagatgcacaatctcacttcgcccaacacgccctacatcctgttctacaagatgtgc
ggccactccaatgagtctaattcggctacggccagctgcagttcgagtatggtatcgcgc
tcaaatgaccaggtggtctctgtgccgctggcgccgcctttgaagctggaggagctgccg
cgtcgacttcgcgactacgtaagaaaggacaaccatgtttacaacgaagagttgaagatg
caacgctttaagcgtggcaacagcggtcatggcaatgcgtttgtcagccgccacaacttc
gatggcgatggtgacgaagacgacaaggggccgccgccgcccggaggatgtggaggaaat
ggactgggcatgaacatcaaccgattcgtattctga

DBGET integrated database retrieval system