KEGG   Drosophila simulans: Dsim_GD25877Help
Entry
Dsim_GD25877      CDS       T01065                                 

Gene name
Dsim_ERp60
Definition
GD25877 gene product from transcript GD25877-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dsi  Drosophila simulans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsim_GD25877 (Dsim_ERp60)
Enzymes [BR:dsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dsim_GD25877 (Dsim_ERp60)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dsim_GD25877 (Dsim_ERp60)
  Exosomal proteins of colorectal cancer cells
   Dsim_GD25877 (Dsim_ERp60)
  Exosomal proteins of bladder cancer cells
   Dsim_GD25877 (Dsim_ERp60)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 489 aa AA seqDB search
MMWRLAGVLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPE
YAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREAS
GIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKY
RFGHSSEKEVLEKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENYHGLVG
HRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQH
ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPE
SNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAEKLQDEDVAIVK
MDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDR
SGKPKKTEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcgcctcgctggagtgctcctactgggcttcatcgccatctcgtccggagcg
gagcaggatgtcctggaactgggggacgacgacttcgccaccaccctgaaacaacacgag
acgacgctggtcatgttctatgccccctggtgcggccactgcaagcgattgaagcccgag
tacgccaaggcggcggagatcgtgaaagacgatgacccgccaatcaaactggccaaggtt
gactgtacggaagctggaaaggaaacgtgcagcaagtactccgtcagcggctacccaacg
ctgaagatcttccgtcaggatgaggtgtcgcaggactacaatggaccacgcgaagccagc
ggcattgccaagtacatgcgcgcccaagtgggacccgcctcaaagaccgtgcgcaccgtt
gccgagctgaagaagttcctggacaccaaggacaccacgctgttcggctacttcagcgac
agcgactccaagctggccaagattttcctgaagttcgccgataagaaccgcgagaagtac
cgctttggacattccagcgaaaaggaagtcctcgaaaagcagggcgaaaccgacaagatt
gtgcttattcgtgcgccccatttgagcaacaagttcgagtcatcttctattaagttcgag
ggtagctccgagtccgatctgtctacctttgtcaaggagaactaccatggtcttgtggga
caccgcactcaggattcggtcaaggacttccagaaccccttgatcactgcctactacagc
gtggactaccagaagaaccccaagggaacgaactactggcgcaaccgtgtgctcaaggtg
gccaaggagtttgtcggtcaaatcaactttgcgatcgcctccaaggatgacttccagcac
gagttgaacgagtatggctacgatttcgttggtgacaagccagtggtattggctcgcgac
gaaaagaatctcaaatacgccctaaaggacgagttctcagtggagaatctgcaggacttt
gtcgagaagctgctggcgaatgagctggagccgtacattaagagtgagcctattcccgag
tcgaacgacgctcccgtcaaggtggccgtcgccaagaacttcgacgatctggttatcaac
aacggcaaagacacgctgattgagttctacgccccatggtgcggccactgcaagaagctg
actcccatctacgaggagctggccgagaagctgcaggacgaagatgtggccatcgtcaag
atggacgccaccgccaacgacgtgccgccggagttcaacgtgcgcggcttccccaccctc
ttctggctgcccaaggacgccaagaacaagccagtcagctacaacggaggtcgcgaggta
gatgacttccttaagtacatcgccaaggaggcgaccacagaactgaagggcttcgaccgc
agcggcaagcccaagaagaccgagctctaa

DBGET integrated database retrieval system