KEGG   Drosophila simulans: Dsim_GD25877Help
Entry
Dsim_GD25877      CDS       T01065                                 

Gene name
Dsim_ERp60
Definition
GD25877 gene product from transcript GD25877-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dsi  Drosophila simulans
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dsi04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 489 aa AA seqDB search
MMWRLAGVLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPE
YAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREAS
GIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKY
RFGHSSEKEVLEKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENYHGLVG
HRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQH
ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPE
SNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAEKLQDEDVAIVK
MDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDR
SGKPKKTEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcgcctcgctggagtgctcctactgggcttcatcgccatctcgtccggagcg
gagcaggatgtcctggaactgggggacgacgacttcgccaccaccctgaaacaacacgag
acgacgctggtcatgttctatgccccctggtgcggccactgcaagcgattgaagcccgag
tacgccaaggcggcggagatcgtgaaagacgatgacccgccaatcaaactggccaaggtt
gactgtacggaagctggaaaggaaacgtgcagcaagtactccgtcagcggctacccaacg
ctgaagatcttccgtcaggatgaggtgtcgcaggactacaatggaccacgcgaagccagc
ggcattgccaagtacatgcgcgcccaagtgggacccgcctcaaagaccgtgcgcaccgtt
gccgagctgaagaagttcctggacaccaaggacaccacgctgttcggctacttcagcgac
agcgactccaagctggccaagattttcctgaagttcgccgataagaaccgcgagaagtac
cgctttggacattccagcgaaaaggaagtcctcgaaaagcagggcgaaaccgacaagatt
gtgcttattcgtgcgccccatttgagcaacaagttcgagtcatcttctattaagttcgag
ggtagctccgagtccgatctgtctacctttgtcaaggagaactaccatggtcttgtggga
caccgcactcaggattcggtcaaggacttccagaaccccttgatcactgcctactacagc
gtggactaccagaagaaccccaagggaacgaactactggcgcaaccgtgtgctcaaggtg
gccaaggagtttgtcggtcaaatcaactttgcgatcgcctccaaggatgacttccagcac
gagttgaacgagtatggctacgatttcgttggtgacaagccagtggtattggctcgcgac
gaaaagaatctcaaatacgccctaaaggacgagttctcagtggagaatctgcaggacttt
gtcgagaagctgctggcgaatgagctggagccgtacattaagagtgagcctattcccgag
tcgaacgacgctcccgtcaaggtggccgtcgccaagaacttcgacgatctggttatcaac
aacggcaaagacacgctgattgagttctacgccccatggtgcggccactgcaagaagctg
actcccatctacgaggagctggccgagaagctgcaggacgaagatgtggccatcgtcaag
atggacgccaccgccaacgacgtgccgccggagttcaacgtgcgcggcttccccaccctc
ttctggctgcccaaggacgccaagaacaagccagtcagctacaacggaggtcgcgaggta
gatgacttccttaagtacatcgccaaggaggcgaccacagaactgaagggcttcgaccgc
agcggcaagcccaagaagaccgagctctaa

DBGET integrated database retrieval system