KEGG   Dactylococcopsis salina: Dacsa_0321Help
Entry
Dacsa_0321        CDS       T02378                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dsl  Dactylococcopsis salina
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dacsa_0321
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dacsa_0321
Enzymes [BR:dsl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Dacsa_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317640..318971
Genome map
AA seq 443 aa AA seqDB search
MNLPTDTPTPSVLKVWGETKLEGQARISGAKNSALAIMAGTILCADECRLRNIPSLVDIN
HMGDVLASVGLKLHREGDVLEINAQEITTSKPPYELVSRLRASFFVIGPLLARLGMARVP
LPGGCAIGARPVDLHVRGLVAMGAKVRIEHGIVHADVPGVNNRLQGAEIYLDYPSVGATE
TILMAATLAEGETRIENAAREPEVVDLANFCVAMGAKIQGAGTNTITISGVPSLHSVDYP
IIPDRIEAGTFLVAGAITNSEISISPVIPEHLIPVLAKLRSMGLKIVTEAPNCLRVIPSS
LQGTDIETLPYPGFPTDMQAQLMALLSLSAGDSVITETVFENRLRHVAELKRMGADMRLK
GQQAIIRGVHQLTGAPVMATDLRASAALVVAGLAAKGITTVQGLHHLDRGYDNLEGKLRQ
LGAKLQRVPAEETDLLVEQPIKV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
attaatttaccaaccgataccccaaccccttctgtcctaaaagtttggggagaaacgaag
ctagaaggacaggctcgcattagtggtgcgaaaaattctgctttggcaattatggcagga
acaatcctttgtgccgatgaatgccgtttacgcaatattccctctttagttgatattaac
cacatgggcgatgttttagccagtgtggggctaaaattacatcgtgagggagatgtttta
gagattaacgcccaagagattactacgtctaaacctccctatgagttggtgtctcgtctg
cgggcaagtttttttgtcattggcccgttgttggctcgtttggggatggcgcgagtgcca
ttaccaggcggttgcgcgatcggtgcgcgtcctgttgaccttcatgtgcgcggtttagtt
gctatgggggcaaaggttcgcattgaacacggaattgttcatgctgatgtgcctggtgtc
aacaatcgcttacaaggggcggagatttatctggattatcccagtgttggcgcaacggaa
acgattttaatggcggctactttagccgaaggagaaactcgcatcgaaaatgcggctcgc
gaaccagaagtggtggatctagcgaatttctgtgttgccatgggcgcgaaaattcagggg
gcgggaacaaatacaatcacgatttctggtgttcccagtttgcacagtgttgattatccg
atcattcccgatcgcattgaagcgggaacgtttttagttgctggtgccattacaaattct
gagatttcgatctctcctgtgattccagagcatttaattccagtgctggcaaaattgcga
agtatgggcttaaaaattgtgacggaagcaccgaattgtttgcgtgtgattccgagttct
cttcaggggactgatatcgaaactttaccttatcctgggtttccgacggatatgcaggcg
caattaatggccttattgtcgctgagtgcgggagatagtgtgattacggaaacggtgttt
gagaatcgcctacgccatgtggcagagttgaaacggatgggcgctgatatgcgtttgaag
ggtcaacaggcgattattcgcggtgttcatcagttgacaggtgcgcccgtaatggcgacc
gatttacgtgcctctgctgcactcgtggtggcgggtttggcagcaaaaggcatcacgact
gttcaagggttacatcacctcgatcgaggctatgataatctcgaaggaaagttacggcaa
ctgggagcaaaattacaacgagtaccagcagaagaaactgatcttctagttgagcaaccg
atcaaagtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system