KEGG   Dactylococcopsis salina: Dacsa_0442Help
Entry
Dacsa_0442        CDS       T02378                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dsl  Dactylococcopsis salina
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dacsa_0442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dacsa_0442
   00052 Galactose metabolism
    Dacsa_0442
   00500 Starch and sucrose metabolism
    Dacsa_0442
   00520 Amino sugar and nucleotide sugar metabolism
    Dacsa_0442
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dacsa_0442
   00524 Butirosin and neomycin biosynthesis
    Dacsa_0442
Enzymes [BR:dsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dacsa_0442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459584..460585
Genome map
AA seq 333 aa AA seqDB search
MKPSTVIGIDIGGTALKIGQFLADGACVNQTTLPTPQPPHPQAMVELIAAAIEQLDPKPN
HRAIGVGTPGPTDPSGRIALIGINLLGWREVPLADLLEAKLGLPTFVANDANCAGLGESW
LGAGRNFQNLILLTLGTGVGGAIILNNQLFTGSYGAAGELGLITIDADGDPCNSGNNGSL
EQHLSVQAIKRKTQKTPTELAKLAASGDKTALAFWEQYGKDLGAGLASLIYVLTPEAILI
GGGISASAEFFLPSTKKEIEKRVVGISRMESQLLTAELGNQAGMVGAAKLAWENLQTATS
RLGEATASPNKSNPTKVGWVKPPLHPTKVIQQK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccatccacagtaattgggattgatatcggaggaacggctctaaaaattggacag
tttctggctgatggtgcttgtgttaatcaaaccacactccccacccctcaaccgcctcat
ccccaggcaatggtagaattaatcgcggcggcgatcgagcaacttgatcccaaaccaaac
catcgcgcgatcggagtgggaacacctggccccactgatccatcaggtcgaattgcctta
atcgggatcaatcttctaggttggcgtgaagttccccttgccgatttattagaagcaaaa
ctaggactccccacatttgttgctaatgatgccaattgtgcgggtttaggagaatcttgg
cttggtgctgggcgtaactttcaaaacttaattctcctcacattaggaacaggagtcggc
ggagcaattatcctcaataatcaactgtttactggttcttatggggctgcaggagagtta
ggcttaattaccattgatgctgacggtgatccctgtaatagtggcaataatggctctctc
gaacaacatttatcagtacaagcaatcaagcgtaaaactcagaaaacaccgacagaatta
gcaaaacttgccgcctctggagacaaaaccgcccttgctttttgggaacaatacggaaaa
gacttaggcgcaggattagccagtttaatctatgttctcacccctgaagcgatccttatt
ggtggtgggattagcgccagtgctgagtttttccttcctagcacgaaaaaagaaatcgaa
aaacgagtcgttggtatttcccgaatggaatcacagcttttaaccgcagaattaggaaac
caagcgggtatggttggggctgcgaaattggcttgggaaaatctccaaacagcaaccagt
aggttgggtgaagccaccgcttcacccaacaaaagtaacccaacaaaagtaggttgggtg
aagccaccgcttcacccaacaaaagtaatccaacaaaagtag

DBGET integrated database retrieval system