KEGG   Dactylococcopsis salina: Dacsa_0625Help
Entry
Dacsa_0625        CDS       T02378                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dsl  Dactylococcopsis salina
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dacsa_0625
  Amino acid metabolism
   00340 Histidine metabolism
    Dacsa_0625
Enzymes [BR:dsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dacsa_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646808..648124
Genome map
AA seq 438 aa AA seqDB search
MLRIITQIAEATTELQRISDRTHNQQTEGKEVAVREILKTVQTEGDQALLDYTEKFDQLT
LTVDQLRVTGSELDAAYQQVSKELIDAIALARKKIEAFHRQRTPKSWVEFGDNQTVLGKR
YTAVDRAGLYVPGGRASYPSTVLMNAVPATVAGVSRRVMVTPPGADGKVNSAVLVAAQEA
GIEEIYRVGGAHAIGALAYGTETIPKVDVITGPGNIYVTLAKKMVYGTVGIDSLAGPSEV
LIIADHNANPVYVAADLLAQAEHDPMAAAILLTTEEKLAQEVQKQVEVQLENHPRRTLTE
KAIAHYGVAVVVKSLTEAAKLSNLFAPEHLELEVEDPWEMLNLIRHAGAIFMGHSTPEAV
GDYLAGPNHTLPTSGAARYASALGVETFMKHSSLIEYSHTALDDVSQAIQTLAQAEGLHS
HSESVRLRMSKQYDQYKC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggattataactcaaatcgcggaagcaacaacagaactacaacggatttccgat
cgcactcacaaccaacaaacagaagggaaagaggtggcggtacgggagattttgaagacg
gtacaaaccgagggggatcaagcactgcttgactataccgaaaagtttgaccaactgacc
ttaacagttgaccagttgcgggtgacagggtcagaactggatgcggcttatcaacaagtg
tctaaggaattaattgatgcgatcgcccttgccaggaaaaaaattgaggcgtttcatcgc
caacgcacgccaaaatcatgggtggagtttggtgacaatcaaaccgtattagggaaacgc
tatactgcggtcgatcgagcgggattatatgtccctggcggacgcgcctcctatcccagc
acggttttaatgaatgctgtccccgcgacagtcgctggggtttcccgacgagtgatggtt
acgccccctggggctgatggaaaagtcaactcggcggtgttggtggcagcacaagaagcg
ggaattgaggaaatttatcgcgtgggaggggcgcacgcgatcggtgcgttagcctatggg
acagaaaccatccccaaagttgatgtcatcaccggtcctggcaacatttacgtcaccctg
gcgaaaaaaatggtttatgggacagtgggaattgactctttagcgggaccctcggaagtt
ttaatcattgcggatcacaatgcaaatcccgtttatgtcgctgcggacttgttagcgcag
gcagaacacgatccgatggcggcggcgattctgctgacgacagaggaaaaattagcgcaa
gaagtacaaaagcaagtagaagtccaattagagaatcatccccgtcgcacactcaccgag
aaggcgatcgcccattatggagtagccgtcgtggttaaatccctcaccgaagcggcaaaa
ctatcaaacttgtttgcaccagaacatttagaattagaagtcgaagacccctgggaaatg
ctgaacttaatccgacacgcgggcgcaatttttatgggtcattccaccccagaagcagtg
ggagattatctcgccggacccaatcatacccttcccacctctggcgcggcgcgttatgct
tcggcgttaggagtggaaacctttatgaagcattctagtttaattgagtattctcatacc
gcgttggatgacgtatcccaagcgattcaaaccttagcgcaagcagagggattacattct
catagtgagtcggtgcgcttacggatgtcaaagcagtatgatcagtataaatgctga

DBGET integrated database retrieval system