KEGG   Dactylococcopsis salina: Dacsa_0829Help
Entry
Dacsa_0829        CDS       T02378                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dsl  Dactylococcopsis salina
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dsl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dsl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828852..829664
Genome map
AA seq 270 aa AA seqDB search
MTVATEKKLPFNWPIFAYIAAIHLVALLAFFPNFFSWSAVGVALIMHWVTGGLGVTLGFH
RLLSHRSLEVPKWLEYFLVFCGTLSAQGSVIDWVGLHRMHHKYSDKNPDPHDSNKGFLWS
HIGWMLHEIPLKEEIPKYTKDVSSDPVYQFFSKYFILIQVAFGLFLYAIGGWSFVIWGVF
VRLAVVFHCTWFVNSATHKFGYKTYESQDESRNCWWVALLTYGEGWHNNHHAYQYSARHG
LQWWELDITWMMIRSLEILGLAKNVKLIKE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgcaactgaaaaaaaactaccattcaattggccgatttttgcctatatcgca
gcgattcatctcgtcgccctcctcgcctttttccccaacttcttcagttggtctgcggtg
ggagtggctttaatcatgcactgggtaacaggaggcttaggggtaactcttggtttccat
cgcttacttagtcaccgtagcttagaagttccgaaatggctagagtatttcctcgtgttt
tgtggcactctttccgcccaaggtagcgtcattgattgggtagggttacaccgaatgcac
cataaatactcggataaaaatcctgatccccatgattccaataaagggtttttatggagt
cacatcggttggatgttacacgaaattcccttaaaagaagagattcctaaatatactaaa
gatgttagttccgaccccgtttatcaatttttctctaaatactttatattgattcaagtt
gcttttggtcttttcctgtatgccattggcggctggtcttttgtgatttggggtgtgttt
gtacgcctagctgtagttttccactgtacttggtttgttaacagtgccactcataaattt
ggctacaaaacctacgagtctcaagatgagtctcggaattgctggtgggttgctctctta
acctatggtgaaggctggcacaataatcatcacgcttatcaatactcagcacgtcacggg
ttacagtggtgggaacttgatattacttggatgatgattcgctccctagaaatcctcggt
ttagccaaaaatgtcaaactgattaaagaataa

DBGET integrated database retrieval system