KEGG   Dactylococcopsis salina: Dacsa_1122Help
Entry
Dacsa_1122        CDS       T02378                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dsl  Dactylococcopsis salina
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dsl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126232..1127071
Genome map
AA seq 279 aa AA seqDB search
MPELPEVETVCRGLNELTQGQVFQGGEVLLKRSIAHPVSIEAFWSGLKNTKIQQWQRRGK
YLLAELSSGGWLGLHLRMSGQLLWVEQSEPLAKHTRVRFFFSEGKELRFIDLRTFGRVWW
VAPDVDLKTVITGLNNLGVEPFSPEFTPTYLGNKLKNRRCAIKTALLDQKVVAGIGNIYA
DETLFLGKISPLREAASLTSSEVEALQQAIISVLSTAIEEGGTTFNSFLNLLGVNGNYMG
RAWVYGREGEVCRECETVIQRCKINGRSSHFCPRCQDVR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaattaccagaagttgaaaccgtttgtcgtgggttaaatgaattaactcaagga
caagtttttcagggtggggaggtgttactaaaacgtagcatcgcccaccccgtttctatt
gaggcgttttggtcgggattaaaaaatactaaaattcaacaatggcaaagacgaggaaag
tatttgttagccgaactttcttcggggggatggttagggctacatcttcgcatgagtggt
cagttgttatgggtggaacaaagtgaaccgttagcgaaacatacaagggtgcgcttcttt
ttttcggaaggaaaggaacttcgttttattgatttaagaaccttcggtcgcgtgtggtgg
gttgcgccagatgttgatctgaaaacggtgattacaggcttaaataatttaggggttgaa
cctttctcgccagagtttacgccgacttatttggggaataaacttaaaaaccgtcgttgt
gccattaaaacggcgttgctagatcaaaaagtggttgcgggaattggcaatatttacgca
gatgagactttatttttgggtaaaatttcaccgttgcgagaggcggcgagtttaacctct
tcagaagtggaagccttacagcaagcaattatttctgttctcagtacggcaattgaggaa
ggaggaacgacttttaatagttttctcaaccttttaggggtgaatgggaattatatgggg
agagcttgggtttatggtcgagagggagaggtttgtcgtgaatgtgaaacggtgattcaa
cgatgcaaaattaatggacggtcttcccatttttgtccccgttgtcaagatgtgcggtag

DBGET integrated database retrieval system