KEGG   Dactylococcopsis salina: Dacsa_1209Help
Entry
Dacsa_1209        CDS       T02378                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00240  Pyrimidine metabolism
dsl00250  Alanine, aspartate and glutamate metabolism
dsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dacsa_1209
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dacsa_1209
Enzymes [BR:dsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dacsa_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFZ49907
UniProt: K9YTS4
Position
complement(1220232..1221212)
Genome map
AA seq 326 aa AA seqDB search
MTTWTKRHILSLETFTPEEYETLLETADQFREVLSRRTKKVPALQGQVVANLFFEPSTRT
RSSFELASKRLSADTLNFTGSSSSLTKGETILDTAKTYVAMGANIMVIRHRQAGVPHTIA
AEMDRLEANVSVFNAGDGQHEHPSQGLLDLFTLYQLLAPASPHQFLQGKKIALVGDILHS
RVARSNLYSLTTMGATVHLAAPPTLLPKTFQAFLNESFSKQLVCHWEIEPALKDADFIMT
LRLQKERMTDHLLPSLREYHQYFGITRHRALLAQDNVKILHPGPVNRGVEISSDLMDDPE
FSLISQQVTSGVAVRMALLYLIGTSR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttggacaaagcgacatattctttctttagaaacctttacccctgaagaatac
gagacacttttagaaaccgccgatcaatttcgagaagtgttatcccgtcgcacgaagaaa
gttccagcgttacaaggacaagtggttgctaatttattttttgagccttccactcgcact
cgcagcagttttgaacttgcttccaaacgtttgtcagcagataccctcaattttacaggg
agttcttcttctttaaccaaaggggaaaccatcctcgacaccgcaaaaacctatgtggcg
atgggtgcaaacattatggtgatccgtcatcgccaagcaggtgttcctcatacgatcgca
gcggaaatggatagactggaagcaaatgttagcgtttttaatgcgggggatggacaacat
gaacatccttcccaaggactgttagatttatttactctgtatcagttgcttgctcctgct
tccccccatcaatttcttcagggaaagaaaattgcgctcgtcggagacattctccattct
cgtgtagcgcgatcaaacttatacagtctaaccacaatgggcgcaacggttcatttagcc
gcgccacccaccttattacccaagacatttcaggcctttttaaacgagtcgttttccaag
caattagtttgtcattgggaaatcgaacccgcgctgaaggatgccgattttattatgacc
ttacggttacaaaaagagcgcatgactgaccatttattgcccagtttacgggaatatcat
caatattttggcattactcgccaccgcgctcttttagctcaagataacgttaaaattctc
catcctggccccgttaatcgcggcgtggaaattagttctgatctcatggatgatccagaa
tttagtttaatctcccaacaagtgaccagtggggtggcggtgcggatggcgttattatat
ttaatcggcaccagtagataa

DBGET integrated database retrieval system