KEGG   Dactylococcopsis salina: Dacsa_1401Help
Entry
Dacsa_1401        CDS       T02378                                 

Definition
(GenBank) putative sensor protein/domain protein
Organism
dsl  Dactylococcopsis salina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DICT CHASE6_C HD_5 HD
Motif
Other DBs
NCBI-ProteinID: AFZ50093
UniProt: K9YVF7
Position
1413230..1414624
Genome map
AA seq 464 aa AA seqDB search
MLEGSILQKLYTAHQGTDRPLNLGVYYKNTLVALCHALEDFILNTKSSPLVISAFQQGKW
YLEEADRYGEIANQARKIAIMAAPDSSFHEHPTGKRDNVDLVSLDAATDSVAQEWHLMIC
SPSYTAMVLCQELSEKDYGRNGQPKHDLERKFYGFWTFEPKLVQETIQLAINHIGNYNSP
LEKELQQHFTEITEQFGKVETENTGVVVSQVVDYLQDSQAELLNQEQASIDQQNSYLPQS
QDLDDNLLSNEMQAFLRMAQLIDQADINNPMAAAEVTALAETMGQVLDIPAWQQKRLRLA
SLLHRLVATLGSTAEKEEDHKTAPACDLIPSVEALRAMPQMSAIARLITHQTENWDGSGK
PGQLAHDQIPLESRILSIVSYFQHRVNELRMNEKSLDQETTLNQAYSECQEQANTRFDPK
LVEALGLLVMGLQQGMTLETAQPKIAAGMWLLDNQDNEQLITNQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaggctcaattttacagaaactttataccgcgcatcaaggaaccgatcgaccc
ttaaatttaggtgtttattataaaaatactctcgtggctttatgtcatgctttagaagat
tttatcctcaataccaaaagttctcctctagtaatcagcgcctttcaacagggaaaatgg
tatctagaagaagccgatcgctatggagaaattgccaatcaagcgcgaaaaattgcaatt
atggcagcgccagatagtagtttccatgaacatcccaccggtaaacgggataacgttgat
ttggtgagtttagacgcagcaactgattccgtagcgcaagaatggcatttgatgatttgt
tcccctagttatacggcgatggtgctttgtcaggagttatcagaaaaagattatggcagg
aatggacagcctaaacatgatttagaacggaagttttacgggttttggacgtttgaaccg
aagttagtacaagaaaccatacaactcgccattaaccatattggaaactataattcccct
ctagaaaaagagcttcaacaacactttaccgagatcacagaacaatttggcaaagtggaa
acagaaaatacaggggtagtggtgtcgcaagtggtggattatctccaagattcccaagcg
gaacttcttaaccaagagcaagccagcatcgatcagcaaaactcctatttaccacaatct
caagacttggatgataatttactctccaacgagatgcaagcgtttctccgtatggcgcaa
ctgattgatcaagcggatatcaataaccccatggcagccgccgaagttaccgcccttgct
gaaaccatgggacaagttttagatattcctgcttggcaacagaaacggttacgattagcg
agtttattacatcgtctggttgctactttggggagtaccgccgaaaaagaggaagatcac
aaaaccgctcctgcttgtgatttaattcccagtgtggaagcattacgggcaatgccacaa
atgagcgcgatcgcgcggttgattacccatcaaactgaaaactgggatggtagcggtaaa
ccaggacaacttgctcatgatcagattcctctagagtctcggatattgagcattgtgagt
tattttcaacatcgggttaatgaacttcgcatgaatgaaaaaagcctcgatcaagaaacc
actctcaaccaagcctattcggaatgtcaagaacaagcaaacacccgttttgatcccaaa
ttagtggaagcattgggattattagtcatgggattacaacaaggaatgaccctcgaaacc
gctcaacccaaaatcgccgctggaatgtggctattagataatcaagataatgaacaatta
atcaccaatcaataa

DBGET integrated database retrieval system