KEGG   Dactylococcopsis salina: Dacsa_1455Help
Entry
Dacsa_1455        CDS       T02378                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00900  Terpenoid backbone biosynthesis
dsl01100  Metabolic pathways
dsl01110  Biosynthesis of secondary metabolites
dsl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dacsa_1455
Enzymes [BR:dsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dacsa_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFZ50142
UniProt: K9YUF6
Position
complement(1470484..1471431)
Genome map
AA seq 315 aa AA seqDB search
MQHYSLTAPAKINLHLEIIGDRADGYHELVMILQGIGLEDRIDLYAGSTQAIHLHCEHPD
VPLGPDNIAYKAAQLMCREYSQAYAQYGGLEITIDKKIPVAAGLAGGSTDAAAVLVGINL
LWKLGLTQPELQTLASQLGSDIPFCLEGGTALALGRGEELSPLQGLDQATVILAKHRNLF
VSTAWAYQSYRQRFGESYYQKPETIEVGKKQAHSADLVSAISQQDYLKIGQLLYNDLEKV
VFPEYPKVEALKSAFQEEKEVLGAMMSGSGPTVFALCSATAKAQDIIENVRSKINDSTVE
FWTTELTNRGIQVKS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcaacattactcactgactgcacccgcgaaaattaatctccacctcgaaatcattggc
gatcgggctgacggatatcacgaactggtgatgattttacaaggaattggcttagaagat
cgcattgatctctatgcgggaagtacccaagccatccatctccactgtgaacatcccgat
gttcctctcggacccgataacatcgcctataaagccgcgcagttgatgtgtcgcgagtat
tcccaagcctacgcgcaatatggaggattagaaatcaccattgataagaagattcctgtg
gcggcagggttagcggggggttcaacagatgcggcggcggtgttagtgggaattaattta
ctgtggaagctaggactgactcaacccgaattacaaaccttagccagtcaactgggatcg
gatattccgttttgtttggaaggaggaacagctttagcattgggacggggagaggaattg
agtcctttacagggtttggatcaagcaacggttatccttgcgaaacatcgtaatttattt
gtttctactgcttgggcttatcagtcctatcgccaacggtttggagagagttattaccaa
aaaccagaaacgatcgaagtggggaaaaaacaagctcattctgctgatttagttagtgcg
atttcccaacaggattatcttaaaattggacaacttttatacaatgatttagagaaggtt
gttttcccagaatatccgaaagtagaggcgttgaagtctgcatttcaggaagaaaaagag
gtcttgggtgcgatgatgtcgggaagtggtccgacggtttttgctctttgttctgccact
gctaaagcccaagatatcatcgaaaatgttcgatcgaaaattaatgattctactgtagaa
ttctggacgacagaattaaccaatcgcggaatacaagttaagtcttaa

DBGET integrated database retrieval system