KEGG   Dactylococcopsis salina: Dacsa_2031Help
Entry
Dacsa_2031        CDS       T02378                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00790  Folate biosynthesis
dsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dacsa_2031
Enzymes [BR:dsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dacsa_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFZ50675
UniProt: K9YWI9
Position
complement(2049608..2050282)
Genome map
AA seq 224 aa AA seqDB search
MSNGSAKVTKTVSLDSASSVEAAVSQNGSEEFSRPEIGEMMEAVKTILEGVGEDPEREGL
LKTPKRVAEAMQFLTQGYEQSLDDLVNGAIFDEGHNEMVLVRDIDVFSLCEHHMLPFMGK
AHVAYIPNEKVVGLSKLARIVEMYARRLQVQERLTRQIAEAIQTILEPQGVAVVMEASHM
CMVMRGVQKPGSWTVTSAMLGVFQEDQKTREEFLNLIRHQPSFH
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacggttcagcgaaagtaaccaaaaccgtgtctctcgatagtgcttcttctgta
gaagcggcggtgagtcaaaatggctcggaagagttttctcgacccgaaatcggagagatg
atggaagcggtgaaaacgattctcgaaggcgtgggagaagacccagaacgagagggtttg
ctcaaaacgccgaaacgggtagcagaagcgatgcagtttctcactcaaggctatgagcag
tctcttgatgatctcgttaacggtgcaatctttgatgagggacacaacgaaatggtgcta
gtgcgagatattgatgtgtttagtctttgtgagcatcatatgttacctttcatgggtaaa
gctcatgtggcttatatcccgaacgagaaggtggtggggttaagcaagttagctcggatt
gtggaaatgtatgctcggcgtttacaagtccaagaacgtctcactcgccaaattgctgag
gcaattcaaaccattctcgaaccgcagggcgtggctgttgttatggaagcaagtcatatg
tgcatggtgatgcgcggtgtgcaaaagccaggttcttggacggttaccagtgcgatgtta
ggggtgtttcaagaagaccagaaaactcgtgaggagtttcttaacttgattcgtcatcag
cccagttttcactag

DBGET integrated database retrieval system