KEGG   Dactylococcopsis salina: Dacsa_2317Help
Entry
Dacsa_2317        CDS       T02378                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dsl  Dactylococcopsis salina
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dsl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dsl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dsl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dsl00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2355773..2357062)
Genome map
AA seq 429 aa AA seqDB search
MIRDIFMPALSSTMTEGKIVSWAKSQGEKVEKGETVLVVESDKADMDVESFHDGYLATIL
VPEGEQAPVGSTIGLLAETEAEIETAKQQGSNQTTATTAKTETKTETPVAPSSTPEPATP
TPQVASTPTSTPKQENGRVVASPRARKLAKEHNIDLATLQGSGPHGRIVASDVEAATGQP
TATPQPQPTPQPAPQPTPQAAPSYAKGEVVPFTTLQSSVVRNMTATVQVPTFHVGYTITT
DALDKLYKQIKSKGVTMTALLAKAVAATLQKHPLVNASYSEQGIQYHSGINIAVAVAMED
GGLITPVLRNAAEQDIYTLSRNWKDLVKRSRSKQLQPEEYSTGTFTLSNLGMFGVDRFDA
ILPPGQGGILAIGASRPQVVATDDGMFGVRRQMSVNITCDHRIIYGAHAAAFLQDLAQLI
ETDPQSLTL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgacatcttcatgcctgctctcagttcaaccatgaccgaaggaaaaattgtc
tcttgggcaaaatctcaaggggaaaaagtagagaaaggagaaaccgtccttgtagtggaa
tcagacaaagcagatatggatgtggagtcgttccatgatggttatttagcgacaattctt
gttccagaaggagaacaagcgccagtgggttctaccattggtttactcgcagaaaccgaa
gcagaaattgaaactgctaaacaacaaggaagcaatcaaaccaccgcaaccactgcgaaa
acagaaacgaaaacggaaacacctgttgctccctcctcaactccagaacccgcaacaccg
actcctcaagtagcttctacgccaacttccactccgaaacaagagaatggtcgcgttgtg
gcttctcctcgcgctcgtaaattagcaaaagagcataatatcgatctcgcaaccttacaa
ggaagcggtccccatggtcgcattgttgcttctgatgtggaagcggcgactggtcaaccg
acggcgactcctcaaccgcaaccgacaccgcaaccagccccccaaccgacaccacaagct
gcaccaagctacgcgaagggagaagttgtcccctttacgactctccaaagttctgtggta
cggaatatgaccgcaacggtacaagttcccactttccatgtcggttataccatcaccact
gatgcgttagataaactctataaacaaattaaatcgaaaggggtgacaatgacggcgtta
ctggcgaaagctgtggcggctactttacaaaaacatccccttgttaatgccagttacagt
gagcaagggatacaatatcactctggaattaatatcgctgttgcggtggcgatggaagat
ggcggtttgattactcctgttttacgcaatgcagcagaacaggatatttataccctttct
cgcaattggaaagatttagtgaaacgatcgcgcagtaagcaattacagccagaagaatac
agcaccggcacgtttactctatcgaatcttggaatgtttggggtcgatcgatttgatgcc
attttaccccctggacagggtggcattctagcaattggtgcgtcccgtccccaagttgta
gcgaccgatgatggaatgtttggtgtgcgtcgtcagatgagtgttaatatcacttgcgac
caccgcattatttatggcgctcatgcggcggctttcttacaagatttagcacagttgatc
gaaactgatcctcaaagtttaactctgtaa

DBGET integrated database retrieval system