KEGG   Dactylococcopsis salina: Dacsa_2360Help
Entry
Dacsa_2360        CDS       T02378                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dsl  Dactylococcopsis salina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dsl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2395171..2397438
Genome map
AA seq 755 aa AA seqDB search
MTPEQIDQIVENQHPNPFSILGAHQIKGKENQTQWVIRAYLPQAKAVWVRLPEAREEYPM
YSNHHPQFFECIIETEKLINYQLRIQEEEREKLIYDPYAFPSPVLTEYDQHLFSEGNHHR
IYEKLGAHLTTVKGVTGVYFATWAPNAKTVSVIGDFNEWGQQKHSMQKRESGIWELFIPQ
ATAGDRYQYLITGENGKTFTKSDPYGFLQEIRPQTASIVADLDQYNWGDENWLEQRRNRD
PLKQPISIYEVHLGSWRQGSVKEPPQTLQGEISPVTMSAENSDARFLTYYELASVLIPYV
KELGYTHIEILPLAEHPYDGSWGYQVTGYYACTSRYGTPQDLMYLIDRCHQNNIGVILDW
VPGHFSKDTHGLGNFDGSHLYEHPDSRRGEHKEWGTYVFNYARPEVRNFLIANALFWFDK
YHIDGLRVDAVASMLYLDYQRQDGEWLPNEYGGRENLDAVEFLRQTNHLLFSYFPGVLSI
AEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNLTFSMWYHHS
ENYVLALSHDEVVHGKSHLIGKMPGDEWQKFANLRCLFAFMFTHPGKKTLFASMEFGQWR
EWNEQTALDWELLEYPFHQRLKGYVGNLNQLYQQQPALYQQDFNEEGFTWIDCNDHRHSV
VSFIRYAEDPSDFLIIICNLTPQPHSHYRVGVPKAGFYREIFNSDSREYGGSNMGNLGGK
WTQEWKFHEQPYSLDLCLPPLAVVMFKIDTEAEMT
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagaacaaattgatcagattgttgaaaaccagcatcctaacccctttagcatt
ctgggggcgcatcaaattaaagggaaagaaaatcaaactcagtgggtaattcgtgcttat
cttccacaagcaaaagcggtttgggttcgcttacccgaagcaagagaagagtatcctatg
tactcaaatcatcatcctcaattttttgagtgcatcatcgaaaccgaaaaactgattaac
tatcaacttcgcatccaagaagaagaaagagaaaaactcatttatgatccttatgcgttt
ccctctcctgttctcacagaatatgatcaacatttattttcagaaggaaaccatcatcga
atttatgaaaaactgggggcgcatttaaccacagttaaaggagtaacaggggtttatttt
gctacctgggcgcccaacgccaaaaccgtttctgttattggtgattttaatgaatgggga
caacaaaagcactcgatgcaaaaaagagaaagtgggatttgggaattgtttattccacaa
gcaacagcaggagaccgttatcaatatctcattacgggggaaaacggaaagacttttact
aaatctgatccttatgggtttctgcaagaaattcgcccgcaaaccgcctcgatcgttgct
gacttagaccagtataactggggagacgaaaactggctagaacaaagacggaatcgcgac
cccttaaaacaacccatatccatttacgaagtccatcttggatcatggcgacaaggttca
gtgaaagaacctccccagaccttacaaggagaaatttcgccagttacaatgtcagcagaa
aacagtgatgcgagatttctcacttattacgaactcgcgtccgttcttattccctacgtc
aaagaattaggctacactcacatcgaaattttacccctagcagaacatccctatgatggg
tcttgggggtatcaagtgacgggatattatgcttgtacttctcgttatggtacccctcaa
gatttaatgtacttgatcgatcgatgtcatcagaataatattggcgtaattctcgattgg
gtgccaggacacttttccaaagatactcatggtttaggaaactttgatggcagtcatctt
tatgaacatccagactcaagacgaggagaacataaagaatggggaacgtatgtttttaat
tatgcccgtccagaggtgcgtaacttccttattgctaacgctttgttctggtttgataaa
tatcatattgacgggttacgagtggatgctgtggcttccatgttgtatctcgattatcaa
cgacaagacggggaatggctaccgaatgagtatggcggaagagaaaatctagatgcggtg
gaatttcttcgtcaaaccaatcatttactgtttagttattttcctggtgttctctcgatc
gcagaagaatccacctcttggccaatggtatcatggcccacctacacaggaggcttagga
ttcaatctgaaatggaatatgggatggatgcacgatatgctggattatttcagcatggat
ccttggttccgtcagtttcatcagaacaacctcacttttagtatgtggtatcaccacagc
gaaaattatgtccttgctttatcccatgatgaagtcgtgcatgggaaaagtcatctcatc
ggaaaaatgcctggggatgaatggcaaaaattcgccaatttgcgctgtttatttgccttt
atgtttactcatcctggaaagaaaaccctattcgcttccatggagtttggacaatggcga
gaatggaatgaacaaaccgccttagactgggaattattagaatatccgtttcaccagcgc
ttaaaaggctatgtgggaaacttaaatcaactctatcaacagcaaccagctttatatcag
caagacttcaacgaagaagggtttacttggattgactgtaatgatcatcgtcatagcgtc
gtttcttttattcgctacgcagaagacccttccgactttttaatcatcatctgtaatctt
acccctcaaccccacagtcattaccgcgttggtgttccgaaagcgggattttaccgagaa
attttcaattctgacagtcgagaatatgggggaagtaatatgggaaatttagggggaaaa
tggactcaagaatggaagtttcacgaacaaccttactcgttagatttatgtttacccccc
ttagctgtagtgatgtttaaaatcgacaccgaagcggaaatgacatag

DBGET integrated database retrieval system