KEGG   Dactylococcopsis salina: Dacsa_2451Help
Entry
Dacsa_2451        CDS       T02378                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dsl  Dactylococcopsis salina
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dsl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2486961..2487596)
Genome map
AA seq 211 aa AA seqDB search
MINYLRGNVVRLIKNTGNRVTLILEVNQIGYEIQIPSRLGRQWEEDNTESAQVFTDQQIR
DDAIVLYGFESAAERDLFRKLIAVNGVGSQMAIALIDTLGLRELVEGIVNENTQLLSKTP
GVGKKTAERIALELKTKLAQWRTEAGLVSQGDESIVPKAEIREDIEMTLLALGYSETEIQ
QALSVISQDSLLAKNPNPEEWIRSAIAWLSQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattatttacgaggtaatgtcgttagattaattaaaaatactggaaaccgcgtc
actttgattttagaagtgaatcaaattggatatgaaattcaaattccctcgcgtttggga
agacagtgggaagaagacaacaccgagtcagcgcaagtgtttactgatcaacaaattcgg
gatgatgcgatcgtgttatatggctttgaaagcgcagcggaaagggatttatttcggaaa
ttaatcgcagtgaatggcgtgggtagtcaaatggcgatcgcgctcattgatactttagga
ttaagggagttagtagaaggcattgtcaacgaaaatacccagttactgtctaaaactcct
ggggtaggaaaaaaaaccgccgagcgtattgccttagaattaaaaacaaaactcgctcaa
tggcgcacagaagcaggtttagtcagtcaaggagacgaaagcattgtgccgaaagcagaa
atccgcgaagatatagagatgacattgttggcgttaggttactcggaaacagaaatacaa
caagcgctttctgtgatcagtcaagattccttactggcgaaaaatcctaacccagaagag
tggattcggagcgcgatcgcgtggctaagtcaataa

DBGET integrated database retrieval system