KEGG   Dactylococcopsis salina: Dacsa_2465Help
Entry
Dacsa_2465        CDS       T02378                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dsl  Dactylococcopsis salina
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dacsa_2465
Enzymes [BR:dsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dacsa_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
join(2502086..2502205,2502205..2503029)
Genome map
AA seq 314 aa AA seqDB search
MNQSHIVVFGSLNMDLVVNTSELPLAGETITGEGFAMIPGGKGANQAIAVSRLGFPCRMV
GRIGKDSFGEILLRSLRESQVDTTGILVDETAHTGVAVITVNRNGENQIIVIPEANGNLD
ETDVDRLRPHLEGAAYLLMQLEVPLASIEAAAELAREMGVKVILDPAPAQPLPFTLYRNL
NIITPNALEAEKLVGFPVTDTDSAQQAATYLQEQGVETVMITLGQQGVYCVNREESFFVP
GFDIEPIIDTVAAGDAFNGGLAVALCSGMNLQRSIICGSAAGALTVTRAGAQSALPDQET
LSTFLGERVGWKEL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtctcatatcgttgtctttggtagtctcaacatggatttagtcgtcaatact
tccgagttgcctttagcaggggaaacgattacaggagaagggtttgcgatgattcctggg
ggaaaaggggcaaatcaggcgatcgcggtgtctcgtttaggcttcccttgtcgcatggtg
ggacgcattgggaaagatagttttggggaaatattgcttcgatcgttgcgagaaagccaa
gtggataccacaggaattttagtggatgaaacggcacacacgggcgttgctgtaatcacg
gttaatcgtaacggagaaaaccagattattgtgattcctgaagccaacgggaatctagat
gaaactgatgtcgatcgcttgcgtcctcacttagaaggggcagcgtatttattgatgcag
ttggaagtccctttagcatcgatcgaagccgccgccgaactggctagagaaatgggagtg
aaagtcattcttgatcctgcaccagcgcaaccgttaccgtttactctttatcgaaacctg
aacatcatcacccccaacgccttagaagcagagaaattagtggggtttcctgtcaccgat
accgattcagcgcaacaagccgccacctatttacaggaacagggcgtggaaacagtaatg
attacattaggacaacagggggtttattgtgtgaatagagaagagagcttttttgtccct
ggattcgatattgaaccaattattgatactgttgcggcaggagatgcgtttaatgggggg
ttagcagtggcgttgtgtagtggaatgaacctgcaacgatcgatcatttgtggctcggcg
gcgggtgcgctgacagtaacccgtgcgggagcgcagtctgctttacccgatcaagaaacc
ctttcaacatttttaggggagcgtgtcggctggaaggaattataa

DBGET integrated database retrieval system