KEGG   Dactylococcopsis salina: Dacsa_2641Help
Entry
Dacsa_2641        CDS       T02378                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dsl  Dactylococcopsis salina
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dacsa_2641
Enzymes [BR:dsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dacsa_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2716994..2717635)
Genome map
AA seq 213 aa AA seqDB search
MTLSTQESPSPALPSLETEAQPVVSEEEMRQAVRTLLLGLGEDPDREGLLDTPKRVVKAL
QFLTSGYHQSIDDLLNGAVFHEDTDEMVLVRDIDLFSSCEHHILPIIGRVHVAYMPNGKV
IGLSKLARICEMYGRRLQVQERLTAQIADAIEGLLQPKGVAVVVEATHMCMVMRGVQKPG
SWTVSSAMRGVFADDPKTRQEFMSLIQHPQNFR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgactttatcaacccaagaatctccatctcctgctttaccttctctagaaaccgaagcc
cagccagtggtctctgaagaagagatgcgccaagctgtccgcactttattgctaggatta
ggagaagaccccgatcgcgaaggattactcgatactccgaaacgagtggttaaagccctt
caattcctaacctctggctatcatcaatccatagacgacttactcaatggggcggttttt
cacgaagataccgatgagatggtcttggttcgagatattgatttatttagttcttgtgaa
caccatattctgcccattattggtcgcgtccatgttgcttatatgcccaacggaaaagtg
atcggattatcgaagttagcacggatttgcgaaatgtatgggcgacgcttgcaagtccaa
gaacgcttaacggctcaaattgctgacgcgattgagggattactccaacccaaaggagta
gcagttgtggtcgaagcaacccatatgtgtatggttatgcgaggcgtgcaaaagccaggc
tcttggacagtttctagtgccatgcgtggggtatttgccgacgatccaaaaacgcgacaa
gaatttatgagtctgattcaacacccccaaaacttccgatag

  All links  
No link information was found.   
DBGET integrated database retrieval system