KEGG   Dactylococcopsis salina: Dacsa_2732Help
Entry
Dacsa_2732        CDS       T02378                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dsl  Dactylococcopsis salina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dacsa_2732
Enzymes [BR:dsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dacsa_2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2801963..2803465)
Genome map
AA seq 500 aa AA seqDB search
MQLDRASGILLHPTSFPSRYGIGDLGATAYEFVDFLAASGQQLWQVLPLGPTGFGNSPYL
SYSALAGNPLLISPDQLLEKGLLTPEEIAQFPNLPEERVDFDRVEAVKMPLLRKAFERFA
NLPEDQRTPYHEFCHKHEYWVEDFAFFMALKEAHNGISWHEWEEGLAKRDPQTLEKWKKH
LGWEIYYHKYLQFEFYRQWKALKNYANERKVKILGDIPIYVAHDSMAVWVHQEIFCLDPE
TCQPSLMAGVPPDYFSEGGQLWGNPVYNWEKVEANGFDWWLHRFEGTLDYVDLLRIDHFR
GFESFWAVPQGEKDARNGYWVQAPGEKFFHILRERLGELPIVAEDLGIITSDVEALRAKF
DFPGMKVLHFAFDSGPGNPYLPFNYYDRNCLVYTGTHDNDTTVGWYKKRKAEQKEIVRQY
LGGISSEGIQWSMIRLALGSVANQAVIPLQDVLGLGSEARMNTPSQLGNNWEWRYGRDQL
TNELRDRLGMLTELYGRSPQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttgaccgagcaagcggaattttattacatcccacctcctttcctagtcgctat
ggaatcggagatttaggcgcaaccgcctacgaatttgtggactttctcgccgccagtgga
caacaattgtggcaagttttgccattaggtcccactgggtttgggaactctccctatcta
tcctattcagctttagctggcaatcccttattaattagtccagatcaattattggaaaaa
ggactattaaccccagaagaaatcgcccaatttcccaatcttcccgaagaaagagtcgat
ttcgatcgagtcgaagcagtaaaaatgccattactgcgaaaagcctttgaacggtttgcg
aaccttcccgaagatcagcgcactccctaccatgagttttgtcataaacatgagtattgg
gtagaagatttcgccttttttatggcgttaaaagaagcccataatggcatcagttggcat
gaatgggaagaaggattagcgaaacgtgatccgcaaaccctagagaaatggaaaaaacac
ctcggatgggaaatttactatcataaatatctccagtttgagttttatcgtcagtggaaa
gcgttgaaaaattacgccaacgaacgaaaagttaaaatcctcggtgatattcccatttat
gttgctcacgacagcatggcggtttgggttcatcaagagattttttgccttgatccagaa
acttgtcaaccgtctttgatggcgggtgttcctcccgattatttcagcgaaggcggacaa
ttatgggggaatcccgtttataactgggagaaagtggaagccaatggctttgattggtgg
ttacatcgctttgaagggactctcgattatgtggatttattgcgaattgaccattttcgg
ggctttgagtccttttgggcggtgccgcaaggggaaaaagatgctcgcaatggctactgg
gtacaggcgccaggagagaagttctttcatattttacgggaacgtctcggtgaattaccg
atcgttgctgaggatttaggaattattacctctgatgtggaagcattacgggctaaattt
gattttccagggatgaaagtgttacattttgcttttgattccggtccaggtaatccctat
ttaccctttaattactacgatcgaaattgtctggtttatactggcactcacgataatgac
accaccgttggctggtataaaaaacgcaaagccgaacaaaaagagattgtgcgacagtat
ttagggggcatttcctcagaagggattcaatggagtatgattcgtttagcgttaggatca
gtggcgaatcaagccgtgattcccttacaggatgttcttggtttaggaagtgaagcgcga
atgaatacccccagtcagttggggaataactgggaatggcgctatggtcgtgatcagtta
accaatgaactgcgcgatcgattgggaatgctaaccgaactttatggtcgatcgccccaa
taa

DBGET integrated database retrieval system