KEGG   Dactylococcopsis salina: Dacsa_2971Help
Entry
Dacsa_2971        CDS       T02378                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dsl  Dactylococcopsis salina
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dacsa_2971
Enzymes [BR:dsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Dacsa_2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3044137..3045207
Genome map
AA seq 356 aa AA seqDB search
MKQSSPNLIDPDDISRPNGQFLGFPYSLEESTIVFFPVPWDATTSYGAGTAKGSQAIIEA
SVQLEPTDYHVYEAWKIGHYTLPIDEKIRAKNDKMRAIAKNIIEYQEAGGHHNDSTIQPE
LEIINEASEKLNDWVYEQSCLLLDQNKLIGLIGGDHSVPFGLMKALSERYNHYGILQIDA
HADLRNAYEGFTYSHASIMHNALKLSEISHLVQVGIRDFSQGEIEQAKADKRAYWFTDWE
MKNKAYQGYVWLDQCQEIINCLPEQVYISFDIDGLNPHFCPHTGTPVPGGLDFNQAIFLI
ETLVKVGKQIIGFDLCEVSPNLKNPDDEWDGNVGARLAYKLANFMFASQRKNQSSS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatcctcccctaatttaatcgatcctgatgacatttctcgtcccaatggtcaa
tttttagggtttccttattccttagaagaatcaacaattgtattttttccagtaccttgg
gatgcgacgacatcttatggcgcgggaacagcaaaaggttcgcaagcaattattgaggca
tctgtacaattagaaccaacagattaccatgtttacgaagcatggaaaatcggtcattat
actctaccaattgatgaaaaaattagagccaaaaatgacaaaatgcgagcaatagcgaaa
aatattatcgaatatcaagaagcaggaggacatcataacgattcaacaattcagcctgag
ctagaaatcattaacgaggcttccgaaaaactgaacgactgggtttacgaacaaagttgt
ttgctcttagatcagaataaattaattggtttaatcggcggtgatcatagtgtaccattt
ggtttaatgaaagcattaagcgaaagatataatcactatggaattttacaaattgatgct
catgccgacttaagaaatgcctatgaagggtttacttattctcatgcttccatcatgcac
aatgccttaaaattatcagaaatttctcatttagtacaggtaggaatcagagatttttct
caaggagaaattgaacaagcaaaagccgataaacgagcatattggtttacagattgggaa
atgaaaaataaagcatatcaagggtatgtgtggttagatcaatgccaagaaattattaat
tgtttacccgaacaagtttatattagtttcgatattgatggcttaaatcctcatttttgt
cctcatacaggaacaccagttccgggtgggttagactttaatcaagcaatttttttaata
gaaacgctggtaaaagtaggaaaacaaatcattggttttgatttatgcgaagtttctcct
aatctcaaaaatcctgacgatgaatgggatggaaatgttggcgcaagactggcttataaa
ttagctaactttatgtttgcttcccagagaaaaaatcaatcatcctcgtag

DBGET integrated database retrieval system