KEGG   Dactylococcopsis salina: Dacsa_3038Help
Entry
Dacsa_3038        CDS       T02378                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dsl  Dactylococcopsis salina
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dacsa_3038
Enzymes [BR:dsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dacsa_3038
Exosome [BR:dsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dacsa_3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3113930..3115441)
Genome map
AA seq 503 aa AA seqDB search
METKQKYVLALDLGTTGNRAIIFDRNGEVVGQSYGELTQYYPQPGWLEHDPMEIWHDTRS
CMEQVLRSTDVAPSEIAATGLTVQRETCLLWDKTTGKPLHRAIVWQDRRTAHYCLELTKK
GYAEKIQNSTGLVLDAYFSASKLSWLLDWVKQNQPEMNLDHVLAGTIDTWILWNLTGRRV
HSTDHSNASRTMLMNLATQQWDAELLDLFGIPVHLMPEIRPSLGDFGAIDAEILGTEIPV
RSVFGDQQAALYAHGCNQKGMLKCTYGTGCFLISQSGQELTRSKHQLLSTVAWSEANGGQ
PVTNYALEGAMFTTGACIQWLRDGMKLIKSAPETETLARQVKDTDGVYFVPALSGLGAPH
WDMNARGAFLGITGGVQREHMVRAVLESIAYQVKEVVDAMNKDSDTPISLLKVDGGASQN
NFLMEFQADVLGIPVERPAILDATAQGAAFGAGLAVGFWNDYDELVAKRKRDRSFIPSKN
QQQAQDQFSIWQKAVGRAKNWMD
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggaaactaagcaaaaatacgtcctcgccctcgatttgggaacaactggaaatcgtgct
attatcttcgatcgaaacggtgaagttgtgggacaatcttatggagaattaacccaatat
tatccgcagccagggtggttagaacatgacccgatggaaatttggcatgatactcgtagc
tgtatggaacaggttttaagaagtaccgatgttgctccttcagaaattgcggcgacgggg
ttaacggtacaacgagaaacctgtttattatgggataaaaccacaggaaaaccgttacat
cgggcgatcgtttggcaagatcggcgcacggctcattactgtctggaattaacgaaaaaa
gggtatgctgagaagattcaaaatagcacgggtttagttttagatgcttatttctcggcg
agtaagttgtcttggttgttggattgggtgaaacaaaatcagccagagatgaatcttgac
catgttttagcgggaacaattgacacctggattctctggaatttaacgggaagacgagtt
catagtacagatcacagcaacgccagccgtactatgttgatgaatttggcaacgcaacag
tgggacgctgagttattagatttatttgggattccagtccatttgatgccggaaattcgt
cctagtttgggagattttggcgcgatcgatgccgagattttagggacagaaattcccgtt
cgatcggtcttcggtgatcaacaagcggcgctttatgctcatggttgtaatcaaaaagga
atgcttaagtgtacttacggaacgggttgtttcctgatttctcaaagcggacaagaattg
acgcgatcgaagcatcaactgctttcaacagtagcttggagtgaagccaatggcggtcaa
cccgtcacgaactacgccttagagggagcaatgttcaccactggcgcttgtatccaatgg
ttgcgagatgggatgaaactgattaaatccgcacccgaaacggaaaccttagcccgtcag
gtgaaagataccgacggcgtttattttgttcctgctttaagtgggttaggtgcgcctcac
tgggatatgaatgctagaggggcgtttttagggattactggcggtgtgcaacgagaacat
atggtgagggcggttttagagtccattgcttaccaagtgaaagaagtggtggatgcgatg
aataaagatagcgatacgccgatctctttgttaaaagtcgatgggggcgcttcccaaaat
aactttttgatggagtttcaagcggatgttttaggaatccctgtggaacgtcccgcgatt
ctcgatgctaccgcacaaggggccgcttttggtgcaggattagcggttggtttctggaat
gattatgatgagttagtggcgaaaagaaagcgcgatcgaagttttatccccagtaaaaat
caacagcaagcgcaagatcaatttagtatctggcaaaaagccgttggacgtgctaaaaat
tggatggattga

DBGET integrated database retrieval system