KEGG   Dactylococcopsis salina: Dacsa_3102Help
Entry
Dacsa_3102        CDS       T02378                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dsl  Dactylococcopsis salina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dsl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3177575..3178390)
Genome map
AA seq 271 aa AA seqDB search
MSLPLSNQTILVTRAAKQSKTFRHLLEKQGATVIEMAALEIRPPSTWEHLDQALRQLSSF
DWLILTSANGVKFFFERLKQLSIDRRLLDSLKMAVVGQKTAAVLEKEGIKPTFIPPNFVA
DSLVAKFPENLSKQKILFPRVESGGREVLIQEFQAQNAEVIAVAAYQSGCPKTVDPIAIE
ALKTQTVDIITFASSKTVQCFYNLLISELGSRVRLREVLAEVYIASIGPQTSQSCQELLN
QCDIEAKVYTLEGLTEAITERISGGKRQEFQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttccgttaagcaatcaaaccattttagttactcgcgccgccaaacaaagtaaa
acctttcgccatttattagaaaaacagggcgcaactgttatcgaaatggcagcattagaa
attcgtccgccttcgacttgggaacatttagatcaggcgcttcgacaattatctagtttc
gattggttgattctaacttcagcgaatggtgtaaaattcttttttgaacggctgaaacaa
ttaagcatcgatcgtcgccttttagactcccttaaaatggcagtggtgggtcaaaaaacc
gccgctgttttagaaaaagaagggatcaaaccaacctttattcctcctaactttgttgct
gattctctagttgctaaatttccagaaaatttatctaaacaaaaaatcctttttcctcgt
gttgaaagtggcgggagagaggtattaattcaggaatttcaagcacaaaatgcggaagtg
attgcggttgctgcttatcaatctggttgtccgaaaacagtcgatccgatcgcgatcgaa
gccctcaaaacccaaaccgttgatataataacctttgcgagttcaaaaaccgttcaatgt
ttttataatcttttgatttctgaattgggttctagggtacgcttaagagaagtcttagca
gaagtctatatcgcttctattggcccccaaacttctcaatcctgtcaagaactacttaat
caatgcgatattgaagccaaagtatatactttagaaggattaacagaagcaatcacagaa
agaatttctggcggaaaacgtcaggaatttcagtaa

DBGET integrated database retrieval system