KEGG   Dactylococcopsis salina: Dacsa_3134Help
Entry
Dacsa_3134        CDS       T02378                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dsl  Dactylococcopsis salina
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dacsa_3134
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dacsa_3134
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dacsa_3134
Enzymes [BR:dsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dacsa_3134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3224179..3225474
Genome map
AA seq 431 aa AA seqDB search
MALATETSNAKPTYTNLVSKEGGTTYDLLPLHVCEETFAPLEVAYDYDAIREQVSRESIA
AGPKSIWRYKPFLPVTGEVIDVGTGMTPLVKSKRLARRLGLKELYIKNDAVNMPTLSFKD
RVVSVALTKAREFGFSTVSCASTGNLANSTAAIAASAGLECCVFIPADLELGKVLGTLIY
NPTVMAVKGNYDQVNRLCSEVANGYGWGFVNINLRPYYSEGSKTLGFEVAEQLGWKLPDH
IVSPLASGSLYTKIYKGFQEFVKTGLVEDKAVRFSGAQAEGCSPISQAFKEGRDFVTPVK
PNTIAKSIAIGNPADGAYALDVARQTNGNIEDVTDAEIIEGIKLLAETEGIFTETAGGTT
IAVLKKLVEAGKIDPDETTVAYITGNGLKTQEAVQGYIGEPFAIDPNLDSFERAWQRSRT
LDRLEWQQVLV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgcaactgaaaccagtaatgcgaaacccacctacaccaatttagtctcgaaa
gaaggaggcacaacctacgacttactccccctccatgtttgcgaagaaacctttgcacct
ttggaagttgcttacgactatgacgcaattcgtgagcaagtgagcagagaaagcattgcg
gccggtcccaagtccatctggcgttacaaaccctttttaccggtcacaggcgaagtcatt
gatgtgggaacgggaatgactcccttagtaaagtcgaagcggttagcccgtcgtctcggc
ttaaaagaactctatattaaaaatgatgcggtgaatatgcccacattgagcttcaaagac
cgcgtggtttctgtggctttaaccaaagcgagagaatttggcttttctaccgtttcctgc
gccagtacgggaaacctcgctaactctaccgccgccatcgctgccagtgcggggttagaa
tgttgtgtgtttattcctgccgatttagaattgggcaaagtgttgggaactttgatttat
aacccaaccgtcatggcagtgaaaggaaactatgaccaagtgaatcgtctctgtagtgaa
gtcgccaacggctatggctggggatttgtgaatattaatcttcgtccctattattccgaa
ggctcgaaaaccctcggttttgaagttgccgaacaattaggatggaaactacccgatcat
attgtttctcctttagcttcaggttctctctatacaaaaatttataaaggtttccaagaa
tttgtaaaaacaggtttagtggaagataaggcggttcgtttcagtggcgcacaagcggaa
ggctgttctcccatttctcaagcattcaaagaaggacgggattttgtcaccccagtaaaa
cccaatacaatcgcaaaatcgatcgcaattggtaatcccgccgatggtgcttatgcttta
gatgtggctcgtcaaaccaacggtaacattgaagatgtcaccgacgcagaaattattgaa
gggattaaactcttagcagaaacggaaggaatctttactgaaaccgccggcggcacaacg
atcgcagtgctgaaaaaattagtagaagctggtaaaattgaccctgacgaaaccacggtt
gcttatatcacaggaaacggattgaaaactcaagaagcagtacaaggttatattggcgaa
ccgtttgcgattgatccgaatttagatagttttgaacgcgcctggcaacggtcacggacg
ctcgatcgtttagaatggcaacaagtgttagtctag

DBGET integrated database retrieval system