KEGG   Dactylococcopsis salina: Dacsa_3217Help
Entry
Dacsa_3217        CDS       T02378                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dsl  Dactylococcopsis salina
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dacsa_3217
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dacsa_3217
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dacsa_3217
Enzymes [BR:dsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dacsa_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3314034..3315146
Genome map
AA seq 370 aa AA seqDB search
MTTTRVSPVSPTPNRLKEQTGWSGLIETYRPFLPVSATTPVVTLLEGNTPLIPALSISER
IGRGVKVYVKYDGLNPTGSFKDRGMTMAISKAKEAGAEAVICASTGNTSAAASAYAVRAG
LKPFVLIPDGYVALGKLAQALLYGAEVIAIDGNFDDCFNLVKDIAQEYPVTLVNSVNPYR
LEGQKTAAFEVVDQLGEAPDWLCIPVGNAGNISAYWMGFCQYHQQNKCEKLPRMMGFQAI
GSAPLVQGYPEKSPDTIATAIRIGNPANWKRALAVQEASQGGFNAVTDEEILDAYRILAR
EEGVFCEPASAASVAGLLKVQDTVPSNTTIVCVLTGNGLKDPQSAIDHAQAQVKAGVASE
LDAVAQAMGF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactactagagtttcgccagttagcccgacgccaaatcgcctcaaggagcagacc
ggttggtctggtctcatcgaaacctatcgtccttttttacccgttagtgccacgactcct
gttgttactctcctcgaaggtaacactcctctgattcccgctctcagcatctcagaacgc
attggacggggagttaaagtttatgttaagtatgatggtttgaatcccactggcagtttc
aaagatcgcgggatgaccatggcaatttctaaggcgaaagaagctggggcagaagcggtg
atttgtgccagtacggggaatacttcggcggctgcgtctgcttatgcggttcgtgcagga
ttgaagccttttgttttgattccagatgggtatgtggctttgggaaagttggcgcaagca
ctcctttatggcgcggaagtgatcgcaattgatggtaattttgatgactgtttcaattta
gttaaggatattgctcaagagtatccagtgactttggttaactcggtgaatccctatcgt
ctggaaggacagaagacggcggcgtttgaagtggtggatcagttgggagaagcaccggac
tggctttgtattcctgtgggtaatgcgggcaatatctcagcatactggatggggttttgt
caataccaccaacagaataaatgtgaaaagttaccgcgcatgatggggtttcaggcaatt
ggatcagcccctttggttcaaggctatcccgaaaagtcccccgatacgatcgccactgcc
attcgtattggtaatcctgctaattggaaacgagcgttggcggtacaggaagccagtcaa
ggtgggtttaatgcggttactgatgaggaaattttggacgcttatcgcatcttggcgcga
gaggaaggggtgttttgtgaacccgcaagcgcggcttctgtggcaggtttattaaaggtt
caggatactgttcctagtaacacgactattgtttgtgtattgactggaaatgggctgaaa
gacccccaaagcgcgatcgatcatgctcaagcacaggtgaaggctggtgtggcttcagaa
ttggacgctgtggcacaagcaatgggattttaa

DBGET integrated database retrieval system