KEGG   Dactylococcopsis salina: Dacsa_3326Help
Entry
Dacsa_3326        CDS       T02378                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dsl01100  Metabolic pathways
dsl01110  Biosynthesis of secondary metabolites
dsl01130  Biosynthesis of antibiotics
dsl01230  Biosynthesis of amino acids
Module
dsl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dacsa_3326
Enzymes [BR:dsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dacsa_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NMO FMN_dh NanE Dus
Motif
Other DBs
NCBI-ProteinID: AFZ51833
UniProt: K9Z0D8
Position
3425948..3426835
Genome map
AA seq 295 aa AA seqDB search
MKIRRRPPNPAVHVNTVRYQVAFPNDEPQNILEKIVWQKEKEVDQRREKLPFLQLGKQVK
DDAPPVRDFLTALKQGKRNPALIAEIKKASPSKGVIREDFDPVALAETYEKAGASCLSVL
TDVSFFQGSFENLGLARKAVELPLLCKEFIIYPYQIYQARLVGADAILLIVAILNDQDLN
YFVKIVNSLGMIPLVEVHTLEELDRALAVEGVKLIGINNRNLEDFSVDTQTTVDLIKQRR
DSLQAKDITVISESGLHTADDLETVKAAGANGVLIGESLLVKPDPSGAIESLYNK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaagacgacctccaaatcctgcggttcatgtgaatacagtacgctatcaa
gtggcgtttcctaatgatgaaccacagaatattttggagaaaattgtttggcagaaagag
aaggaagttgaccaaagacgagaaaaacttccttttcttcagttaggaaaacaggtaaaa
gatgatgcaccaccagtgcgagatttcctaaccgctttaaaacagggaaaacgtaatcca
gcgttgattgctgagattaaaaaagcctctcccagtaaaggggtgattcgagaagatttc
gatcccgttgctttagcagaaacctatgagaaagctggggcgagttgtttgtctgtgtta
accgatgtcagtttttttcagggaagttttgagaatttagggttggcaagaaaagcagtc
gagttgcctttattatgcaaagagtttattatttatccttatcaaatttatcaagcgcgt
ctggttggtgcggatgcgattttattgattgtagcaatcttaaatgatcaagatttaaac
tattttgtgaaaattgttaatagtttaggaatgattccccttgtggaagtgcatacttta
gaagaactcgatcgagctttagcggtggaaggagtaaaattgatcgggattaataaccgc
aaccttgaagatttttccgtagatacccaaaccacagttgatctcattaagcaacggcga
gactccttacaagccaaagatatcactgtaattagtgagtctggattacatacagcagat
gatctagaaacggtaaaagccgctggtgcaaatggtgtactaattggagaatctttatta
gtcaaacctgatcccagtggcgcgatcgagtccctttataataaataa

DBGET integrated database retrieval system