KEGG   Dactylococcopsis salina: Dacsa_3393Help
Entry
Dacsa_3393        CDS       T02378                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00860  Porphyrin and chlorophyll metabolism
dsl01100  Metabolic pathways
dsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dacsa_3393
Enzymes [BR:dsl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Dacsa_3393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase MCM AAA_5 AAA_22 AAA_16 Sigma54_activat AAA_29 ABC_tran DUF815 AAA AAA_18 AAA_30 Filament AAA_27 AAA_28 AAA_33 RNA_helicase MMR_HSR1 AAA_7
Motif
Other DBs
NCBI-ProteinID: AFZ51891
UniProt: K9YY65
Position
complement(3499938..3501026)
Genome map
AA seq 362 aa AA seqDB search
MTVTAETPPIAKKMRRRVVFPFTAIIGQEDMKLALLLNVIDPKIGGVMIMGDRGTGKSTT
IRALADLLPEIEIVTSDPFNSHPDDPDLMSEEVRSKWEEEEELPRAQQKVPMIDLPLGAT
EDRVCGTIDIEKALSEGVKAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNT
VEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMNVEVRTVRDPELRVKIVEQRSEF
DQAPQDFTAQYQQQQTELQQKIVQAQTLLPQVQMEYDLRVKVSQVCGELDVDGLRGDIVT
NRAAKALAALEGRTEVTVEDIRQVMPFCLRHRLRKDPLESVDSGYKVEKAIAQVFGLELE
ED
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaccgcagaaacgcctcctattgccaaaaaaatgcgccgtcgggtcgtgttt
ccctttaccgctattatcggtcaggaagacatgaaattagccttgttgctcaatgtcatt
gatcctaaaatcggtggcgtgatgattatgggcgatcgaggaacgggaaaatcgacgacg
attcgcgctttagctgatttgcttcctgaaatcgagattgttacaagtgatccgtttaac
agtcatccagatgatcccgatttgatgagtgaagaagtgcgaagcaagtgggaagaggaa
gaagagcttccgagagcgcagcagaaagttcccatgattgatctgcctttaggagcaaca
gaagaccgagtttgtggcacgatcgacattgaaaaagcactttcagaaggggtcaaagcc
tttgaacctggattactcgcaaaagcaaaccgaggtttattatatgtggatgaggtgaac
ttattagatgatcaccttgtggatgtgttattagactccgctgctagtggttggaataca
gtagaacgggaagggatttcgattcgtcacccagcgcggtttgtgttggtgggttcggga
aacccagaagagggagaactacgtccgcaattgctcgatcgattcgggatgaatgtagaa
gtccgaacagtaagagacccagaattacgggtaaaaattgttgagcagcgatcggaattt
gatcaagcgccgcaagactttaccgcacaataccaacaacagcaaactgaattacaacaa
aaaatcgtgcaagcgcaaacccttctcccccaagtccagatggaatatgacctacgggta
aaagtttcccaagtctgcggcgaattagatgtggatgggttacgcggtgacattgttacc
aatcgagcggcaaaagccctcgcagcgttagaaggacgcaccgaggtaacagttgaggat
atccgtcaggtaatgccattctgtctccgtcatcgtctgcgaaaagaccccttagagtct
gtcgattctggttacaaagtcgaaaaagcgatcgcgcaggtgtttggtttggaattagaa
gaagactaa

DBGET integrated database retrieval system