KEGG   Dactylococcopsis salina: Dacsa_3436Help
Entry
Dacsa_3436        CDS       T02378                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dsl  Dactylococcopsis salina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dacsa_3436
Enzymes [BR:dsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dacsa_3436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3540848..3542233
Genome map
AA seq 461 aa AA seqDB search
MVETLIVGAGISGLTTAYRLHEQQHEVMVAEKNDRAGGNITSKASGGFLWEEGPNSFSPT
PELLKLAVDVGLKDEFVFADPTLPRYVYWQGKLLPVPMSPPAAVKSQLLSPLGKLRALTG
AIGFVPPKVATEEETVAEFFTRHLGSEVAQRLVSPFVSGVYAGDVANLSASAAFARVTQL
ADVGGGLVAGAILSRGKKKKATTEVNSEIPKTRSGELGSFREGLQQLPSSIARKLGEAVK
FNWELKQISQTSEAGYIATFSTPEGEQNVEAQQIILTTPAYVNAPILQDLSPEASQALRE
IDYPPVACVVLAYPDEAFSVPLDGFGNLNPRSEGVRTLGTIWSSTLFSGRTPQGWQILTN
FIGGATDPEIAQLSEEEIVQQVHQDLQKTIVKPNTTPKPLAVHLWSQAIPQYTLGHLDRI
ARIKESLKPFSGLFLSSNYLDGVALGDCVRRGEETAAQILR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggtagagactttaattgtcggagcaggaattagtggtttgaccactgcttatcggtta
catgagcaacaacatgaggtgatggtagccgaaaagaacgatcgagcagggggaaacatt
accagcaaagccagtgggggtttcctctgggaagaaggacccaatagcttttccccgacc
ccagaattgctaaaactggcggtagatgtggggttaaaagatgagttcgtatttgccgat
ccgacgcttccccgttatgtttattggcaggggaaactacttcctgttcccatgagtccc
ccagcggcggtaaaatcgcaactactgagtccattggggaaactgcgagcgttaacgggt
gcgatcgggtttgttcccccaaaggtggcgactgaagaagaaacagtggcggaatttttc
acccgtcatttaggctcggaagtggcgcagcgattggtgagtccttttgtttctggggtg
tatgctggagatgtggcaaacttgagcgcttcggcagcttttgcacgagtgacgcaattg
gcggatgtgggaggcggattggttgctggggcaattttatctcgtggcaagaaaaaaaag
gcaaccactgaggttaattcagagattcccaaaacgcgatcgggagaattaggatcattt
cgagaagggttacagcaattaccaagctcgatcgcccgtaaattaggagaggcggtaaaa
ttcaattgggaactaaaacagatttcccagacttcagaagcgggctacattgccactttt
tccaccccagaaggagaacaaaacgtggaagcgcagcaaatcatcctcacgactcctgct
tatgttaacgctccaattttacaagacttatccccagaagcgagtcaagcgctgagagaa
attgattatccgccagtggcttgtgtggttctcgcgtatcccgatgaagccttcagtgtg
ccattagacgggtttggtaatctcaatccgcgtagtgaaggagtccgtactttaggaaca
atttggtcttctactttgttttctggacgtactcctcaaggttggcagattctgactaat
tttatcggcggcgcaactgatcctgaaattgctcaactcagtgaagaagagattgttcaa
caagtccatcaagacttacagaaaaccatagttaaaccgaatacgacaccgaaaccccta
gcggttcatttatggtcgcaagcgattcctcaatatacccttggacatctcgatcgaatc
gcgagaattaaagagagtttgaaaccgttttcggggctatttttatccagcaactatctt
gatggcgttgcgttaggagattgtgtgcggcgcggggaagaaacagcagcccagattctt
agataa

DBGET integrated database retrieval system