KEGG   Dactylococcopsis salina: Dacsa_3436Help
Entry
Dacsa_3436        CDS       T02378                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dsl  Dactylococcopsis salina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dsl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3540848..3542233
Genome map
AA seq 461 aa AA seqDB search
MVETLIVGAGISGLTTAYRLHEQQHEVMVAEKNDRAGGNITSKASGGFLWEEGPNSFSPT
PELLKLAVDVGLKDEFVFADPTLPRYVYWQGKLLPVPMSPPAAVKSQLLSPLGKLRALTG
AIGFVPPKVATEEETVAEFFTRHLGSEVAQRLVSPFVSGVYAGDVANLSASAAFARVTQL
ADVGGGLVAGAILSRGKKKKATTEVNSEIPKTRSGELGSFREGLQQLPSSIARKLGEAVK
FNWELKQISQTSEAGYIATFSTPEGEQNVEAQQIILTTPAYVNAPILQDLSPEASQALRE
IDYPPVACVVLAYPDEAFSVPLDGFGNLNPRSEGVRTLGTIWSSTLFSGRTPQGWQILTN
FIGGATDPEIAQLSEEEIVQQVHQDLQKTIVKPNTTPKPLAVHLWSQAIPQYTLGHLDRI
ARIKESLKPFSGLFLSSNYLDGVALGDCVRRGEETAAQILR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggtagagactttaattgtcggagcaggaattagtggtttgaccactgcttatcggtta
catgagcaacaacatgaggtgatggtagccgaaaagaacgatcgagcagggggaaacatt
accagcaaagccagtgggggtttcctctgggaagaaggacccaatagcttttccccgacc
ccagaattgctaaaactggcggtagatgtggggttaaaagatgagttcgtatttgccgat
ccgacgcttccccgttatgtttattggcaggggaaactacttcctgttcccatgagtccc
ccagcggcggtaaaatcgcaactactgagtccattggggaaactgcgagcgttaacgggt
gcgatcgggtttgttcccccaaaggtggcgactgaagaagaaacagtggcggaatttttc
acccgtcatttaggctcggaagtggcgcagcgattggtgagtccttttgtttctggggtg
tatgctggagatgtggcaaacttgagcgcttcggcagcttttgcacgagtgacgcaattg
gcggatgtgggaggcggattggttgctggggcaattttatctcgtggcaagaaaaaaaag
gcaaccactgaggttaattcagagattcccaaaacgcgatcgggagaattaggatcattt
cgagaagggttacagcaattaccaagctcgatcgcccgtaaattaggagaggcggtaaaa
ttcaattgggaactaaaacagatttcccagacttcagaagcgggctacattgccactttt
tccaccccagaaggagaacaaaacgtggaagcgcagcaaatcatcctcacgactcctgct
tatgttaacgctccaattttacaagacttatccccagaagcgagtcaagcgctgagagaa
attgattatccgccagtggcttgtgtggttctcgcgtatcccgatgaagccttcagtgtg
ccattagacgggtttggtaatctcaatccgcgtagtgaaggagtccgtactttaggaaca
atttggtcttctactttgttttctggacgtactcctcaaggttggcagattctgactaat
tttatcggcggcgcaactgatcctgaaattgctcaactcagtgaagaagagattgttcaa
caagtccatcaagacttacagaaaaccatagttaaaccgaatacgacaccgaaaccccta
gcggttcatttatggtcgcaagcgattcctcaatatacccttggacatctcgatcgaatc
gcgagaattaaagagagtttgaaaccgttttcggggctatttttatccagcaactatctt
gatggcgttgcgttaggagattgtgtgcggcgcggggaagaaacagcagcccagattctt
agataa

DBGET integrated database retrieval system