KEGG   Dactylococcopsis salina: Dacsa_3450Help
Entry
Dacsa_3450        CDS       T02378                                 

Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
dsl  Dactylococcopsis salina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dacsa_3450
Enzymes [BR:dsl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Dacsa_3450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3552347..3556336
Genome map
AA seq 1329 aa AA seqDB search
MFTNVKSTIRHISPDSIGDRSLVKVVYVVLEPQYQSALSASVRSINANNPNVAIEISGYL
IEELRDPENYEAFKHDVAEANLFIGSLIFIEDLADKVVEAVQPHRDNLDAAIVFPSMPQV
MRLNKLGSFSMAQLGQSKSAIAQFMRKRKEKQGASFQDGMLKLLQTLPKVLKYLPLDKAQ
DARNFMLSFQYWLGGSQDNLENFLLMLTDKYVLQQEHQQEVNYGEPVVYPDMGIWHPLAP
KMFEDVKEYLSWYNNRSDISDDLKDPLNPCIGLVLQRTHLITGDDAHYVAVVSELEAMGA
RVIPIFAGGLDFSKPVDEYFWDTAAQGVEALPIVDAVVSLTGFALVGGPARQDHPKAIES
LKRINRPYMVALPLVFQTTEEWEESELGLHPVQVALQIAIPELDGGIEPIILSGRDGATG
RAIALQDRVETIAQRAMKWAKLRRKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSIYQ
VLQGLRNNGYDVGDLPESSKELMELVLHDAQAQYASPELNIAYRMSVPEYERLTPYSENL
HENWGPPPGELNSDGENLLIYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAY
YTYLEKVWGADAVLHFGTHGSLEFMPGKQMGMSGDCYPDSLIGSIPNLYYYAANNPSEAT
IAKRRSYAETISYLTPPAENAGLYKGLQELQDLIGSYQSLKDNGRAVQIVNTIMDQARIV
NLDKDVHIPDQDAGEMTPEERDTLVGLLYKQLMEISSRLLPCGLHVIGQPPTAEEAIATL
VNIASLDREEEDIQGLPRSIAESLGRDIEEIYRNNDKGVLSDVQLLQDITAAVQDAVAAL
VHAQADANGRVSQVSKLNFFNMGKKEPWLKALHDLGYTKVDREKMKPLFEYLEFCLEQVI
ADNELGGLLRGLEGEYILPGPGGDPIRNPNVLPTGKNIHALDPQSIPTAAAVKSAKVVID
RLLDRHRAENGGQLPETIASVLWGTDNIKTYGESLAQILCLIGVKPVPDSLGRINKLELM
SLEELGRPRIDVVVNCSGVFRDLFINQMALLDQGVKMAAEADEPLEMNFVRKHAMEQAKE
NGINLRQAATRIFSNASGSYASNVNLAVENSSWEDESELRDMYLNRKSFAFDADNPGIMS
ENRKIFESALKTADVTYQNLDSSEISLSDVSHYFDSDPTKVVSSLREDGKQPAAYIADTT
TANAQVRSLSETVRLDARTKMLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATAGAVDN
WVYEDTNDTFIKDKEMQERLLNLNPNSFRRMVTTLLEANGRGYWETSEENLDRLRELYQE
AEDRIEGIE
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgttcactaacgtcaagtccaccattcgccacatttcaccagactcgatcggggatcgg
tctcttgttaaggtggtctatgtcgtgcttgagcctcaatatcagagcgctctctcagca
tcggttcgatcgatcaacgccaataatcccaatgttgcgatcgagattagcggttactta
attgaagaactccgtgatcctgagaattacgaggcatttaagcacgatgtagccgaagcc
aacctgtttattggttcattaattttcattgaagatttagcagataaagtcgtagaagcg
gtacaaccgcaccgcgacaatttagatgcggcgatcgtcttcccttctatgccccaagtg
atgcgtctcaacaagttgggaagtttctccatggcgcaattagggcaaagcaaaagcgcg
atcgcgcaatttatgagaaaacgcaaggagaaacaaggcgcatccttccaagacgggatg
ttaaaactcctgcaaaccttaccaaaagttttaaaataccttcctttagataaagcccaa
gatgctcgtaacttcatgttatcgttccagtattggctaggcggttctcaggacaactta
gagaacttcttgctgatgctgacggataaatatgttttacaacaagaacaccaacaagaa
gttaactacggtgaaccggttgtctatcctgatatgggaatttggcatcctctcgcccca
aaaatgtttgaggatgttaaagaatacctcagttggtataacaatcgcagtgatatctca
gacgacttgaaagaccccttaaatccctgtattggtttagttttacaacggacgcactta
atcacaggtgatgatgcccactatgtggctgtggtttcagaattagaagccatgggcgcg
agagtgattccaatttttgctggtggtttagacttctccaaacccgtagatgagtatttc
tgggatacagcagcccaaggcgtagaagcgttaccgattgtggatgctgtggtttcttta
accggatttgccttagtaggcggccccgcgcgtcaagaccatccgaaagccattgaatcc
ctcaaacgcattaatcgcccctatatggtagcgttaccccttgttttccagacaacagaa
gaatgggaagaaagtgagttaggattgcatcccgtacaggtcgcactacagattgcaatt
ccagaactcgacggtggtattgaaccgatcatcctttcaggacgagatggcgcaacaggt
cgcgcgatcgccctccaagatcgagtcgaaaccattgcccaacgggcgatgaaatgggca
aaattgcgccgtaaaccgaaactcgataaaaaagtcgccattaccgtctttagcttccct
cccgataaaggaaacgtgggaactgccgcttatctcgatgtgtttggcagcatttaccag
gttttacagggactccgtaacaacggctacgacgtgggagacttacccgaatcctcaaaa
gaactgatggaactggtgttacacgacgcacaagcgcaatatgccagcccagaattaaat
atcgcctatcggatgtccgttcccgaatacgaacgactcaccccctactccgaaaatctc
cacgaaaactggggtcccccacccggagaactgaacagcgacggcgaaaacctcctcatc
tacggaaaacaattcggaaatgtcttcatcggcgttcaacccacctttggttacgaaggt
gatccgatgcgtctcctcttctctcgttctgcttctccccatcatggttttgctgcctac
tacacctacttagaaaaagtctggggtgccgatgcagtgttacatttcggaacacatggt
tctctggagtttatgccaggcaaacaaatgggaatgtctggagattgctatcccgacagt
ctcattggtagcattcctaacctgtactactacgccgccaataatcccagtgaggcgacc
attgccaaacgtcgcagctacgccgaaaccatttcttatctcacccctcctgcggaaaat
gcagggctttataaaggcttacaggaattacaagacttgattgggtcttatcagagtctt
aaagataacggtcgcgctgtgcaaattgtgaatacaatcatggatcaagcgcggattgtg
aatctggataaagatgttcacattcccgaccaagatgcgggagaaatgaccccagaagaa
cgggatactctcgtcggtttgctttataaacagttaatggaaatttcctctcgtttgctt
ccttgtgggttgcacgtcattggacagccaccgactgcagaagaagcgatcgcaacgtta
gtgaatattgcgtcactcgatcgcgaagaagaggacatccaaggtcttccccgtagcatc
gccgaaagtctcggacgagacattgaggaaatttaccgcaataatgacaaaggggtttta
agtgatgtgcaactgttacaagacatcaccgctgccgtccaagacgcagtcgccgcctta
gttcacgcccaagctgatgccaacggacgggtttctcaagtctccaaattgaacttcttt
aacatggggaaaaaagaaccctggctgaaagccctccatgacctcggttatacgaaggtc
gatcgcgaaaaaatgaaacccctgtttgaatatctggagttttgcttagaacaagttatc
gctgataacgaactcggtggactcttacgcggtttagaaggagaatatatcttacctgga
cccggtggcgatccgattcggaatcccaatgttttacccacaggaaaaaatattcatgcc
cttgatccgcagtccattcccacagctgccgccgtcaaatcagcaaaagtcgtgatcgat
cgactcttagatcgtcaccgcgccgaaaatgggggacaacttcccgaaacgatcgcctct
gtactttggggaacggataacattaagacttatggggaatctctcgcacaaatcctttgc
ttaatcggtgtgaagcctgttcccgactctctcggacgcatcaacaaattagaattgatg
tccttagaggaactgggtcgtcctcgcattgatgtggttgttaactgttctggggttttc
cgtgacctgtttattaaccaaatggcgctgttagaccaaggggtgaaaatggcagccgaa
gcagacgaacccttagagatgaattttgttcgtaaacacgccatggaacaagcaaaagaa
aacggcattaacctccgtcaagcagcgacgcggattttctctaatgcgtccggttcttat
gcgtctaacgttaacctcgccgtggaaaacagttcttgggaagacgaatctgagttacga
gatatgtatctcaatcggaagtcctttgctttcgatgcggataacccagggattatgagt
gaaaatcggaaaatctttgaatcggcattaaaaaccgccgatgtcacttatcaaaactta
gattcttctgaaatcagtctcagtgacgtttcccactattttgactctgatcccactaaa
gttgtgagtagtcttcgggaagatggcaaacaacccgccgcttacattgcggataccact
acagcaaacgcccaagtgcggagtttatcggaaaccgtgcgtcttgatgcgcggacgaag
atgttaaacccgaaatggtatgagggaatgctgagtcacggttatgaaggcgtgcgcgag
ttatctaagcgtttagtgaatacaatgggctggagtgcgactgctggcgctgtggataac
tgggtgtatgaagacaccaacgataccttcatcaaagacaaggaaatgcaggaacgttta
ttaaacctgaatccgaattccttccgtcgcatggtgacaaccctgttggaagccaacgga
cgcggttactgggaaaccagcgaagaaaacctcgatcgtctgcgtgaattgtatcaagaa
gcagaagaccgcatcgaagggattgaataa

DBGET integrated database retrieval system