KEGG   Dichomitus squalens: DICSQDRAFT_106148Help
Entry
DICSQDRAFT_106148 CDS       T03133                                 

Definition
(RefSeq) ferredoxin reductase-like protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dsq  Dichomitus squalens
Pathway
dsq00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dsq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DICSQDRAFT_106148
Enzymes [BR:dsq01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     DICSQDRAFT_106148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 18833630
NCBI-ProteinID: XP_007365979
JGI: 106148
UniProt: R7SZL1
Position
Unknown
AA seq 366 aa AA seqDB search
MLRAASHPTRYRPVLAPIHRYGFSRQLSTEKSPALTSKSRSTALLVGLGSGALVASYFLW
PDPSRAAPTKRNALLSPSHFTPVTVTSTEPCPDPNTRLMTLAVPRNSLPSLNEAAFEPIW
SVYIKDDDIQVERPFTPLEGMDSEGRMKFWVKKYEKGEVGRWLHSKKAGDTIEIRGPLKT
WAWRPDEWDEVVMISGGTGITPFCQLVYKELLSQSPPNTQTRFTLLHSSRRPTELPPSEM
LAPLVAYSQAHPDRLRLSLFVDTPDGPAHPAVPSSSLTVGRIGREAIERATDSGDGHRSW
WRSLFSASPKPKPQEAGDGRKIVFLVCGPDPMVAAIAGPFGRNFSQGDVGGLLGNLGYDK
DSVWKL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggctgcctcccatcctactcgctaccgccctgtgcttgctccgatacacaga
tatggcttctcgcggcagttgtcgacagagaaatcaccagcgttgacatcaaagtctcgt
tccacagctctcctagtcggccttggaagcggagccctcgtagcctcttactttctctgg
ccggatccctctcgcgctgcgcccaccaagaggaacgccctgctttctccatcgcacttc
acaccagtgaccgtcacctccacagaaccatgtccagacccaaacacccgcctcatgaca
ctcgctgttccacggaactcattaccctccctcaacgaggctgcttttgagcccatctgg
tctgtttacatcaaggatgacgacatccaggtcgagcgtcccttcacgccgttggaaggc
atggacagtgaagggcgcatgaagttctgggtcaagaaatacgagaaaggtgaagtgggc
cgctggctgcactccaagaaggccggcgacacgatagaaatacgcggtccgctcaaaacc
tgggcctggagaccggacgagtgggacgaggtggtcatgatttcagggggcacggggata
acgcccttctgccagctcgtctacaaggaattgctcagccaatcccctccgaacacgcag
acgcgcttcacgctgctgcactcctcccgtcggccgacagagctccccccgtcggagatg
ctcgcccctctagtagcctattcccaggcgcaccccgacaggctcaggctatcactcttc
gtggacacgcccgatggtcctgcgcatccggcagtgccttcctcttcgttgaccgtgggc
cgaattggaagagaagctattgaacgtgcgacggactcgggcgacggccatagaagctgg
tggcgaagcctattcagcgcttcgccgaagccgaaaccacaggaagctggcgatggaagg
aagatcgtatttctcgtctgcggacccgacccaatggtcgcagcaatcgcgggaccattt
ggtcggaacttctctcaaggggacgttggtgggttgcttgggaatttgggatacgacaaa
gactcggtgtggaagttgtag

DBGET integrated database retrieval system