KEGG   Dichomitus squalens: DICSQDRAFT_107360Help
Entry
DICSQDRAFT_107360 CDS       T03133                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dsq  Dichomitus squalens
Pathway
dsq00052  Galactose metabolism
dsq00500  Starch and sucrose metabolism
dsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DICSQDRAFT_107360
   00500 Starch and sucrose metabolism
    DICSQDRAFT_107360
Enzymes [BR:dsq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     DICSQDRAFT_107360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Sortilin-Vps10
Motif
Other DBs
NCBI-GeneID: 18833706
NCBI-ProteinID: XP_007366735
JGI: 107360
UniProt: R7SWX9
Position
Unknown
AA seq 527 aa AA seqDB search
MPPVGSLSEPHEDSWRPQVHFSPPEGFMNDPNGLFVDAQGTYHLYYQYNPTGILAGNQHW
GHATSKDLFHWFDQPIAIYPPDAESQVFSGSVVIDVKNTSSFFPDQSDGVVAIYTLNTPG
AQVQEIAYSRDGGYTFTPFEGNPVIDGQSTQFRDPKVVWHAETQRWIMVVAYAQEFIVAI
YTSPDLKTWTHASDYSHHGLLGLQYECPNLVRVPVRDAVGAPQTEYDMYVLTLSINPGAP
LGGSTTQYFPGNFDGTQFTPVDGATRLADFAKDNYAAQFFYGTPEGEDALSLGWASNWQY
TEATPTAREGWRGVMTLPRRSFLTRNSREGWVLVSLPVELSPVLCPGPIRVTREHLGGDM
RFEADLRAVKSGAYHFEIVLPTFSRTATEARLTFELSSSASGESVSGGWLFALGGDCHFY
LDRGRTHGFDHPLFTDGFSTSVVAPGEGDCTWTLSAVFDRSILEVFVNGGAASATMTVFP
EGRLTMLAVRTAGIPEDVLVNVVVHGLKSVWEGGRPRSIPRSRVDAT
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtcgggtctttatcagaaccacacgaggactcgtggcgaccacaagtccac
ttctcgccgcccgagggatttatgaatgacccgaatggcctcttcgtcgatgcgcagggt
acctatcatctgtattaccaatacaatccaacgggtatcctagccggaaatcagcactgg
ggccatgcaaccagcaaggacctcttccactggttcgaccagcccatcgcaatatatcca
cccgatgccgaatcgcaagtcttcagtggctccgtggtaattgacgtgaagaacacatcc
agcttcttcccagaccaatcagatggcgtagtggccatctacaccctcaacactcctggc
gcgcaagttcaggagattgcctactctcgcgacggagggtacacattcacgccttttgag
ggcaatcctgtcatcgatggccagtctacacagttccgcgatccgaaggtcgtttggcat
gcggagactcagcgctggatcatggtcgtcgcgtacgcacaggagttcatcgtcgctatc
tacacctctcccgacctcaagacttggacccatgcctctgactactcgcaccacggcctc
ctcggtctccaatacgagtgccccaacctcgtccgcgtacctgtgcgtgatgccgtaggc
gccccccagaccgaatacgatatgtacgtcctgactctcagcatcaaccccggcgccccc
ctcggcggctcgacgacccagtacttccccggcaatttcgacggcacgcaattcacgcca
gtggatggcgcgacgcgtctcgcggacttcgcgaaggacaattacgccgcccagttcttc
tacgggaccccggaaggcgaggacgcgctctctctcgggtgggcgtccaattggcagtac
accgaggcgacgcccaccgctcgggagggctggcgcggggtgatgaccctcccgcgacgc
agcttcctcacgaggaactcgcgtgagggctgggttctagtctcgctccctgtcgaactg
agtcctgtcctttgcccgggtcccatcagagtcacacgggagcatctgggcggggacatg
cgattcgaagccgacctccgtgccgtcaagagcggcgcgtaccatttcgaaatagtcctc
ccaacgttttcccgcacggctaccgaagcccggcttacctttgaactctccagttctgct
tcgggcgagtctgtgtctgggggctggcttttcgcgctcgggggcgactgccacttctat
ctggaccgcgggcgcacgcatggcttcgaccacccactgttcacggacgggttctctacg
tccgtcgtcgcgcctggtgagggagactgcacctggacgctctctgcggtgttcgacagg
agcattctggaggtgtttgtgaatgggggcgcggcgagcgcgacgatgactgtgtttccg
gaggggcgcctgaccatgcttgcggtgcgcactgcggggataccggaggacgtgctcgta
aacgtcgttgtccatgggctgaagagtgtatgggagggcggtcgtccgcggagtatcccg
cggtcaagagtggacgccacctaa

DBGET integrated database retrieval system