KEGG   Dichomitus squalens: DICSQDRAFT_171036Help
Entry
DICSQDRAFT_171036 CDS       T03133                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dsq  Dichomitus squalens
Pathway
dsq00052  Galactose metabolism
dsq00500  Starch and sucrose metabolism
dsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DICSQDRAFT_171036
   00500 Starch and sucrose metabolism
    DICSQDRAFT_171036
Enzymes [BR:dsq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     DICSQDRAFT_171036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 18839260
NCBI-ProteinID: XP_007366734
JGI: 171036
UniProt: R7SXZ7
Position
Unknown
AA seq 558 aa AA seqDB search
MISMKSLFWTLLSTVVGGRALTLPDGSVLLDATSDVNGRLWRPQVHFSPPSGFMNDPNGL
HIDENGIYHLYYQYNPTCLTGGNQHWGHATSQDLYHWVDQPIAISPPDPNSLIWSGSAIV
NVNNTSGLFSNQTNGVVAIYTLNNNTAGRQVQEIAYSLDGGYTFTRYSGNPVINVNSNSF
RDPKVFWHAATQRWVVVVAHSNDLFLEIYTSPDLKNWTSVSTFSRHGFLGFQYECPNLVR
IPLRDASGAIIPTSDDTYVLTVSVSPGTPLGGSTIQYFPGTFNGSHFTPVDDATRFVDIA
QDNYAAQFFYGLPDGDDALLLGWASNTAYTNLVPTAQEGWRGAHTIPRRLFLTNSGQGGW
DLVSLPANISAVFDPSPSGVIQNSFNGSGTVTVDLSAVTSNAYYFEVNVTGLQVAGPSVD
GTDLGSTLAFTLSSPTTNESVSGGFLFGLGSAYLDRSHTNGFQIPLFTDKFSTTAGAVDG
MWTLSAVWDRSILELFLGGGVQSATALAYPQEPLTQFTVNTHAFSAGAVVNVTIYALESV
WSGNGTRTIPTSPVIPLA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgatgaagtcactcttttggacgttgctgagcactgtagtgggcggtcgtgcc
ttgacactaccagacggtagcgtcctgcttgatgccacttccgacgtgaatgggcgtctg
tggagaccacaggtgcacttctcgcctccctcaggcttcatgaacgacccaaatggtctc
cacatcgacgagaatggtatctaccatttgtactatcaatataatccgacttgcctaacc
ggagggaatcagcactggggccatgcgaccagccaggacctctaccactgggtcgaccag
cccattgcgatctctccgcctgatcccaactcgctcatatggtccggctccgcgatcgtc
aacgtcaacaacacttccggtctcttttccaatcagaccaatggggttgtcgccatctac
actctcaacaacaacaccgccggccggcaagtgcaagagatcgcgtattcgctagacgga
gggtacaccttcacgcgttactcaggaaacccggtcatcaacgttaactcgaattcgttc
cgcgaccccaaagtcttctggcatgcggcgactcagcgttgggttgtggtcgttgcgcat
tcgaacgacctgttcctcgagatctatacctctcccgatctaaagaattggactagtgtg
tctaccttctcacgccacggcttccttggtttccagtacgagtgcccaaacctagtccgt
atacccttgcgtgacgcctcaggtgccataataccgacttcggacgacacgtatgttctc
accgtcagcgtcagccctggaacgccgctcggtggatccacgatccagtacttcccagga
acgttcaatggctcgcacttcacgcctgttgacgacgcgacgcgcttcgtggacatcgcg
caggacaactacgccgcccagttcttctatgggcttcccgatggcgacgacgcgctcctc
ttgggttgggcgtcgaacaccgcgtacacgaatttggtgccaaccgcgcaggagggctgg
cgcggcgcgcacacgatcccccgccggttgttcctcacgaactccgggcaaggcggttgg
gatctcgtctcgctccccgccaacatcagcgctgtgttcgatcccagccccagcggggtc
atacaaaacagcttcaacgggagcggaactgtgacggtggacttgagcgcagtgaccagc
aatgcgtactactttgaggtgaacgtcaccgggctgcaagttgcgggaccctcggtggac
ggcacagacctcggatcgacgcttgcgttcacgctctctagccctactacgaacgagtcg
gtctcaggaggcttcctcttcggattgggctcagcatacttggaccgctcgcacacgaac
gggttccagatcccactgttcactgacaaattttcgacgaccgccggggccgttgacggg
atgtggacgctttctgcggtatgggataggagcattctagaattgttcctgggtgggggc
gtgcagagcgcgacggcgctggcctacccgcaggagccgctgacacaattcacggtgaac
actcatgcgttctcggcgggcgccgtcgtgaatgtcactatctacgcgttggagagtgtg
tggtctgggaacgggacgcggaccattccgactagtcctgtgatccctttggcatga

DBGET integrated database retrieval system