KEGG   Dechlorosoma suillum: Dsui_0071Help
Entry
Dsui_0071         CDS       T01657                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase-like enzyme
  KO
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dsu  Dechlorosoma suillum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Module
dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Dsui_0071
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dsui_0071
Enzymes [BR:dsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Dsui_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(67885..68448)
Genome map
AA seq 187 aa AA seqDB search
MSQRFVIRDTPLAGLRVLLRQPLGDQRGYLERMYCADELEALVEGRFVVQINHTYTLAKG
TVRGMHYQLPPHAETKFVSCLRGEIFDVAVDLRAGSPTFLQWHAELLSAENHKTLVIPEG
FAHGFQTLSEDCEMLYFHTKAYEPTAERGLSATDPHMQIQWPLPVGGLSPRDLAHSPLDA
TFTGIML
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtttcgtcatcagggataccccgcttgcaggcttgcgagtgttgctccgc
cagccactgggggatcagcggggttatctggagcgcatgtattgcgccgacgagctggag
gccctcgtggagggccggttcgtcgtgcagatcaaccatacctatacccttgccaaaggt
acggtacggggaatgcactatcagttgcccccccatgctgaaaccaaatttgtttcatgc
ctgcggggcgagatatttgatgtggcggtggacctccgggctggatctcccaccttcctg
caatggcatgccgaattactgagtgccgaaaaccacaagaccctcgtgattcccgagggg
tttgcccatggtttccaaaccttgagtgaagattgcgaaatgctttatttccatacgaag
gcttatgagccgacagctgagcgtgggttgagcgcaactgacccgcatatgcaaattcaa
tggcctctcccagttggtggactgtcaccaagggatctggcccattccccgctggatgcc
acctttacggggataatgctgtga

DBGET integrated database retrieval system